5-HT2B Recombinant Protein Antigen

Images

 
There are currently no images for 5-HT2B Protein (NBP1-90322PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

5-HT2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR2B.

Source: E. coli

Amino Acid Sequence: TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HTR2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90322.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-HT2B Recombinant Protein Antigen

  • 5-HT(2B)
  • 5HT2B
  • 5-HT2B
  • 5-HT-2B
  • 5-HT2B5-HT 2B receptor
  • 5-hydroxytryptamine (serotonin) receptor 2B
  • 5-hydroxytryptamine 2B receptor
  • 5-hydroxytryptamine receptor 2B
  • HTR2B
  • Serotonin receptor 2B

Background

Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-78403
Species: Hu
Applications: ICC/IF, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-56352
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-46557
Species: Mu, Rt
Applications: IHC, WB
NLS590
Species: Hu, Pm
Applications: IHC,  IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-90319
Species: Hu
Applications: IHC,  IHC-P
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for 5-HT2B Protein (NBP1-90322PEP) (0)

There are no publications for 5-HT2B Protein (NBP1-90322PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT2B Protein (NBP1-90322PEP) (0)

There are no reviews for 5-HT2B Protein (NBP1-90322PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5-HT2B Protein (NBP1-90322PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT2B Products

Array NBP1-90322PEP

Research Areas for 5-HT2B Protein (NBP1-90322PEP)

Find related products by research area.

Blogs on 5-HT2B

There are no specific blogs for 5-HT2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5-HT2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2B