Recombinant Human 5-HT1E GST (N-Term) Protein

SDS-Page: Recombinant Human 5-HT1E Protein [H00003354-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human 5-HT1E GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 206-276 of Human 5-HT1E
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: HTR1E
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 33.55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT1E GST (N-Term) Protein

• 5HT1E
• 5-HT1E
• 5-HT-1E
• 5-hydroxytryptamine (serotonin) receptor 1E
• HTR1E
• S31
• S31,5-HT1E5-hydroxytryptamine receptor 1E
• Serotonin receptor 1E

Background

5HT1E Receptor, also known as 5-hydroxytryptamine receptor 1E, is a 365 amino acid protein that is 42 kDa, belongs to the G-protein coupled receptor 1 family, has cell membrane intracellular location; commonly found in the cortex, caudate putamen, claustrum, hippocampus, and amygdala; is one of the many different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that plays a role of a neurotransmitter, a hormone, and a mitogen; this receptor activity is mediated by G proteins that inhibit adenylate cyclase activity. The protein is being studied for its involvement in attention deficit hyperactivity disorder, autism spectrum disorder, chronic fatigue syndrome, hermaphroditism, pharyngitis, neuronitis, and skin papilloma. This protein has been linked to the GPCR downstream signaling, GPCR ligand binding, class A/1 (Rhodopsin-like receptors), serotonin receptors, amine ligand-binding receptors, intracellular calcium signaling, signal transduction, G alpha (i) signaling events, neuroactive ligand-receptor interaction, and amine ligand-binding receptors pathways where it interacts with PSMC3, PSMC4, ADORA3, ADORA1, ADRA2A, APP, CCR3 and over 100 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HTR1E