We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human 5-HT1E GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human 5-HT1E Protein [H00003354-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human 5-HT1E GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 206-276 of Human 5-HT1E

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HTR1E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
33.55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT1E GST (N-Term) Protein

  • 5HT1E
  • 5-HT1E
  • 5-HT-1E
  • 5-hydroxytryptamine (serotonin) receptor 1E
  • HTR1E
  • S31
  • S31,5-HT1E5-hydroxytryptamine receptor 1E
  • Serotonin receptor 1E

Background

5HT1E Receptor, also known as 5-hydroxytryptamine receptor 1E, is a 365 amino acid protein that is 42 kDa, belongs to the G-protein coupled receptor 1 family, has cell membrane intracellular location; commonly found in the cortex, caudate putamen, claustrum, hippocampus, and amygdala; is one of the many different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that plays a role of a neurotransmitter, a hormone, and a mitogen; this receptor activity is mediated by G proteins that inhibit adenylate cyclase activity. The protein is being studied for its involvement in attention deficit hyperactivity disorder, autism spectrum disorder, chronic fatigue syndrome, hermaphroditism, pharyngitis, neuronitis, and skin papilloma. This protein has been linked to the GPCR downstream signaling, GPCR ligand binding, class A/1 (Rhodopsin-like receptors), serotonin receptors, amine ligand-binding receptors, intracellular calcium signaling, signal transduction, G alpha (i) signaling events, neuroactive ligand-receptor interaction, and amine ligand-binding receptors pathways where it interacts with PSMC3, PSMC4, ADORA3, ADORA1, ADRA2A, APP, CCR3 and over 100 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
NBP2-92762
Species: Hu, Mu, Rt
Applications: ELISA, WB
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-90319
Species: Hu
Applications: IHC,  IHC-P
NBP3-16043
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-14109
Species: Hu
Applications: IHC,  IHC-P
NBP1-46557
Species: Mu, Rt
Applications: IHC, WB
NB100-56352
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
NBP1-90322
Species: Hu
Applications: IHC,  IHC-P
NB100-58983
Species: Bv, Ca, Eq, Gp, Hu, Pm, Mu, Pm, Rt
Applications: ELISA, IHC,  IHC-P
NBP2-20212
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-2269
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB

Publications for 5-HT1E Partial Recombinant Protein (H00003354-Q01) (0)

There are no publications for 5-HT1E Partial Recombinant Protein (H00003354-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT1E Partial Recombinant Protein (H00003354-Q01) (0)

There are no reviews for 5-HT1E Partial Recombinant Protein (H00003354-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT1E Partial Recombinant Protein (H00003354-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT1E Products

Research Areas for 5-HT1E Partial Recombinant Protein (H00003354-Q01)

Find related products by research area.

Blogs on 5-HT1E

There are no specific blogs for 5-HT1E, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT1E GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR1E