17 beta-HSD14/HSD17B14 Antibody

Images

 
Western Blot: HSD17B14 Antibody [NBP1-85220] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HSD17B14 Antibody [NBP1-85220] - Staining of human stomach shows strong cytoplasmic positivity in Chief cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

17 beta-HSD14/HSD17B14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
17 beta-HSD14/HSD17B14 Protein (NBP1-85220PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 17 beta-HSD14/HSD17B14 Antibody

  • 17 betaHSD14
  • 17 beta-HSD14
  • dehydrogenase/reductase (SDR family) member 10
  • Dehydrogenase/reductase SDR family member 10
  • DHRS10
  • DHRS1017-beta-hydroxysteroid dehydrogenase 14
  • EC 1.1.1.-
  • HSD17B14
  • hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10
  • retinal short-chain dehydrogenase/reductase 3
  • Retinal short-chain dehydrogenase/reductase retSDR3
  • retSDR3
  • RETSDR3,17-beta-HSD 14
  • SDR3
  • SDR47C1
  • short chain dehydrogenase/reductase family 47C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01793
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8016
Species: Hu
Applications: WB, IHC
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF5828
Species: Hu
Applications: WB, ICC, Neut
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220) (0)

There are no publications for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220) (0)

There are no reviews for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 17 beta-HSD14/HSD17B14 Products

Bioinformatics Tool for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220)

Discover related pathways, diseases and genes to 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220)

Discover more about diseases related to 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220).
 

Pathways for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220)

View related products by pathway.

PTMs for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220)

Learn more about PTMs related to 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220).
 

Research Areas for 17 beta-HSD14/HSD17B14 Antibody (NBP1-85220)

Find related products by research area.

Blogs on 17 beta-HSD14/HSD17B14

There are no specific blogs for 17 beta-HSD14/HSD17B14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 17 beta-HSD14/HSD17B14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B14
Entrez