17 beta-HSD14/HSD17B14 Antibody - Azide and BSA Free

Western Blot: 17 beta-HSD14/HSD17B14 Antibody [H00051171-B01P] - Analysis of HSD17B14 expression in transfected 293T cell line by HSD17B14 polyclonal antibody. Lane 1: DHRS10 transfected lysate(29.7 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

17 beta-HSD14/HSD17B14 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse 17 beta-HSD14/HSD17B14 Antibody - Azide and BSA Free (H00051171-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: HSD17B14 (NP_057330.2, 1 a.a. - 270 a.a.) full-length human protein. MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
• Specificity: HSD17B14 - hydroxysteroid (17-beta) dehydrogenase 14,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HSD17B14
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 17 beta-HSD14/HSD17B14 Antibody - Azide and BSA Free

• 17 betaHSD14
• 17 beta-HSD14
• dehydrogenase/reductase (SDR family) member 10
• Dehydrogenase/reductase SDR family member 10
• DHRS10
• DHRS1017-beta-hydroxysteroid dehydrogenase 14
• EC 1.1.1.-
• HSD17B14
• hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10
• retinal short-chain dehydrogenase/reductase 3
• Retinal short-chain dehydrogenase/reductase retSDR3
• retSDR3
• RETSDR3,17-beta-HSD 14
• SDR3
• SDR47C1
• short chain dehydrogenase/reductase family 47C, member 1

Background

17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 (PubMed 17067289)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B14
• Entrez:
  • 51171(Human)
• Uniprot:
  • NP_057330.2(Human)