Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human 14-3-3 zeta/delta Protein [H00007534-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-245 of Human YWHAZ full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
YWHAZ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
54.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein

  • KCIP-1MGC126532,14-3-3-zeta
  • MGC111427
  • MGC138156
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide
  • zeta polypeptide

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4925
Species: Mu
Applications: WB, Simple Western, IHC
H00008398-D01P
Species: Hu, Mu
Applications: WB
MAB5018
Species: Hu
Applications: WB, IP
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-31344
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
7270-IL/CF
Species: Hu
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
AF2364
Species: Hu
Applications: WB, IHC

Publications for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01) (0)

There are no publications for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01) (0)

There are no reviews for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01). (Showing 1 - 1 of 1 FAQ).

  1. Is the product 14-3-3 zeta/delta Recombinant Protein H00007534-P01 dry ice shipment?
    • The recombinant protein you inquired about, H00007534-P01, does ship on dry ice and has a storage requirement of -80C.

Other Available Formats

Additional 14-3-3 zeta/delta Products

Bioinformatics Tool for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01)

Discover related pathways, diseases and genes to 14-3-3 zeta/delta Recombinant Protein (H00007534-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01)

Discover more about diseases related to 14-3-3 zeta/delta Recombinant Protein (H00007534-P01).
 

Pathways for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01)

View related products by pathway.

PTMs for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01)

Learn more about PTMs related to 14-3-3 zeta/delta Recombinant Protein (H00007534-P01).
 

Research Areas for 14-3-3 zeta/delta Recombinant Protein (H00007534-P01)

Find related products by research area.

Blogs on 14-3-3 zeta/delta

There are no specific blogs for 14-3-3 zeta/delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 14-3-3 zeta/delta GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAZ