![Immunocytochemistry/Immunofluorescence: ZYG11B Antibody [NBP1-82255] - Staining of human cell line U-2 OS shows localization to intermediate filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ZYG11B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82255-img0006.jpg "Immunocytochemistry/Immunofluorescence: ZYG11B Antibody [NBP1-82255] - Staining of human cell line U-2 OS shows localization to intermediate filaments. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DATGVNADITITDIISGLGSNKWIQQNLQCLVLNSLTLSLEDPYERCFSRLSGLRALSITNVLFYNEDLAEVASLPRLESLDISNTSI |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZYG11B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZYG11B |
![Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human lymphoid tissues shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/ZYG11B-Antibody-Immunohistochemistry-Paraffin-NBP1-82255-img0010.jpg "Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human lymphoid tissues shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ZYG11B-Antibody-Immunohistochemistry-Paraffin-NBP1-82255-img0007.jpg "Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human testis shows moderate to strong cytoplasmic and membranous positivity in cells in seminiferious ducts.](http://images.novusbio.com/fullsize/ZYG11B-Antibody-Immunohistochemistry-Paraffin-NBP1-82255-img0008.jpg "Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human testis shows moderate to strong cytoplasmic and membranous positivity in cells in seminiferious ducts.")
![Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/ZYG11B-Antibody-Immunohistochemistry-Paraffin-NBP1-82255-img0009.jpg "Immunohistochemistry-Paraffin: ZYG11B Antibody [NBP1-82255] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")