ZYG11A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZYG11A Antibody [NBP2-57550] - Staining of human cell line SiHa shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZYG11A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSREMEVSYFAAGIIAHLTSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWAL
Specificity
Specificity of human ZYG11A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZYG11A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZYG11A Recombinant Protein Antigen (NBP2-57550PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZYG11A Antibody

  • zyg-11 homolog A (C. elegans)
  • ZYG-11A early embryogenesis protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76825
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00011026-M01
Species: Hu
Applications: WB, ELISA

Publications for ZYG11A Antibody (NBP2-57550) (0)

There are no publications for ZYG11A Antibody (NBP2-57550).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZYG11A Antibody (NBP2-57550) (0)

There are no reviews for ZYG11A Antibody (NBP2-57550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZYG11A Antibody (NBP2-57550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZYG11A Products

Bioinformatics Tool for ZYG11A Antibody (NBP2-57550)

Discover related pathways, diseases and genes to ZYG11A Antibody (NBP2-57550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZYG11A Antibody (NBP2-57550)

View related products by pathway.

Blogs on ZYG11A

There are no specific blogs for ZYG11A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZYG11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZYG11A