ZNRF3 Antibody

Images

 
Immunohistochemistry: ZNRF3 Antibody [NBP1-90758] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNRF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCACCCEPQPSPAGPSAGAAGSSTLFLGPHLYEGSGPAGGEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCCFYEEKQVAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNRF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNRF3 Protein (NBP1-90758PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNRF3 Antibody

  • BK747E2.3
  • KIAA1133
  • novel C3HC4 type Zinc finger (ring finger)
  • RNF203
  • zinc and ring finger 3
  • zinc/RING finger protein 3
  • ZNRF3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1120
Species: Mu
Applications: WB, IHC
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1617
Species: Hu
Applications: WB
NLS3593
Species: Hu, Po, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28904
Species: Hu, Po
Applications: ICC/IF (-), WB, IHC, IHC-Fr, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
MAB3000
Species: Hu, Mu, Rt
Applications: WB
NBP2-56973
Species: Hu
Applications: WB, ICC/IF
NBP1-90758
Species: Hu
Applications: IHC, IHC-P

Publications for ZNRF3 Antibody (NBP1-90758) (0)

There are no publications for ZNRF3 Antibody (NBP1-90758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNRF3 Antibody (NBP1-90758) (0)

There are no reviews for ZNRF3 Antibody (NBP1-90758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNRF3 Antibody (NBP1-90758). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody against ZNRF3 that reacts against mouse and has been tested in IHC. I am interested in your ZNRF3 antibody (NBP1-90758), which was designed to react against human tissue. The antibody info indicates that it is predicted to cro
    • Our product NBP1-90758 has only been tested in human samples. We list the closest species identities on our database based on homology to the immunogen sequence. In this case, mouse shares 77% homology to the antibody sequence.

Secondary Antibodies

 

Isotype Controls

Additional ZNRF3 Products

Bioinformatics Tool for ZNRF3 Antibody (NBP1-90758)

Discover related pathways, diseases and genes to ZNRF3 Antibody (NBP1-90758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNRF3 Antibody (NBP1-90758)

Discover more about diseases related to ZNRF3 Antibody (NBP1-90758).
 

Pathways for ZNRF3 Antibody (NBP1-90758)

View related products by pathway.

PTMs for ZNRF3 Antibody (NBP1-90758)

Learn more about PTMs related to ZNRF3 Antibody (NBP1-90758).

Blogs on ZNRF3

There are no specific blogs for ZNRF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNRF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNRF3
Entrez