![Western Blot: ZNF653 Antibody [H00115950-B01P] - Analysis of ZNF653 expression in human liver.](http://images.novusbio.com/fullsize/ZNF653-Antibody-Western-Blot-H00115950-B01P-img0004.jpg "Western Blot: ZNF653 Antibody [H00115950-B01P] - Analysis of ZNF653 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | ZNF653 (NP_620138.1, 1 a.a. - 615 a.a.) full-length human protein. MAERALEPEAEAEAEAGAGGEAAAEEGAAGRKARGRPRLTESDRARRRLESRKRYDVRRVYLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGSASDSEESPEGQPVKAAAAAAAATPTSPVGSSGLITQEGVHIPFDVHHVESLAEQGTPLCSNPAGNGPEALETVVCVPVPVQVGAGPSALFENVPQEALGEVVASCPMPGMVPGSQVIIIAGPGYDALTAEGIHLNMAAGSGVPGSGLGEEVPCAMMEGVAAYTQTEPEGSQPSTMDATAVAGIETKKEKEDLCLLKKEEKEEPVAPELATTVPESAEPEAEADGEELDGSDMSAIIYEIPKEPEKRRRSKRSRVMDADGLLEMFHCPYEGCSQVYVALSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETCGKSFKRKNHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCDRCGKRFEKLDSVKFHTLKSHPDHKPT |
| Specificity | ZNF653 - zinc finger protein 653, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ZNF653 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00115950-B01P | Applications | Species |
|---|---|---|
| Sievers Q L, Petzold G et al. Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN. Science 2018-02-11 [PMID: 30385546] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF653 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: ZNF653 Antibody [H00115950-B01P] - Analysis of purified antibody to ZNF653 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/ZNF653-Antibody-Immunocytochemistry-Immunofluorescence-H00115950-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZNF653 Antibody [H00115950-B01P] - Analysis of purified antibody to ZNF653 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: ZNF653 Antibody [H00115950-B01P] - Analysis of ZNF653 expression in transfected 293T cell line by ZNF653 polyclonal antibody. Lane 1: ZNF653 transfected lysate(67.65 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZNF653-Antibody-Western-Blot-H00115950-B01P-img0005.jpg "Western Blot: ZNF653 Antibody [H00115950-B01P] - Analysis of ZNF653 expression in transfected 293T cell line by ZNF653 polyclonal antibody. Lane 1: ZNF653 transfected lysate(67.65 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")