![Western Blot: ZNF577 Antibody [NBP2-86524] - WB Suggested Anti-ZNF577 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: OVCAR-3 cell lysate](http://images.novusbio.com/fullsize/ZNF577-Antibody-Western-Blot-NBP2-86524-img0001.jpg "Western Blot: ZNF577 Antibody [NBP2-86524] - WB Suggested Anti-ZNF577 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: OVCAR-3 cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit ZNF577 Antibody - BSA Free (NBP2-86524) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF577. Peptide sequence: NTVPIEMPSSGTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF577 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF577 |
![Western Blot SOCS-3 Antibody (516919) [Unconjugated]](https://images.novusbio.com/images2/SOCS-3_MAB5696_Western_Blot_6252.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Western Blot Prox1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Prox1_AF2727_Western_Blot_16724.jpg)
![Immunocytochemistry Prox1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Prox1_AF2727_Immunocytochemistry__Immunofluorescence_18644.jpg)
![Simple Western Prox1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Prox1_AF2727_Immunocytochemistry__Immunofluorescence_18654.jpg)
![Immunocytochemistry Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Immunocytochemistry_11033.jpg)
![Immunohistochemistry Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Immunohistochemistry_22974.jpg)
![Simple Western Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Simple_Western_20223.jpg)
![Immunocytochemistry ONECUT2/OC-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ONECUT2_AF6294_Immunocytochemistry_10608.jpg)
![Immunocytochemistry ONECUT2/OC-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af6294_human-onecut2-oc-2-affinity-purified-polyclonal-ab-immunocytochemistry-1832022103352.jpg)
![Western Blot SOCS-4 Antibody (517331) [Unconjugated]](https://images.novusbio.com/images2/SOCS-4_MAB5628_Western_Blot_6246.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
