Home » ZNF45 » ZNF45 Antibodies » ZNF45 Antibody

ZNF45 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZNF45 Antibody [NBP2-86491] - WB Suggested Anti-ZNF45 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Transfected 293T
Western Blot: ZNF45 Antibody [NBP2-86491] - WB Suggested Anti-ZNF45 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Transfected 293T

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZNF45 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF45. Peptide sequence: RVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF45 Antibody

  • HZF1Zinc finger protein HZF1
  • KIAA2007
  • zinc finger protein 1
  • zinc finger protein 266

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZNF30 Antibody
NBP1-84108
Immunohistochemistry-Paraffin: ZNF30 Antibody [NBP1-84108] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunocytochemistry/Immunofluorescence: ZNF30 Antibody [NBP1-84108] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF224 Antibody
NBP2-30794
Immunohistochemistry-Paraffin: ZNF224 Antibody [NBP2-30794] - Staining of human prostate shows weak positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: ZNF224 Antibody [NBP2-30794] - Staining of human kidney shows moderate nuclear positivity in cells in tubules, as well as moderate nuclear membrane positivity in glomeruli cells.
Immunohistochemistry-Paraffin: ZNF224 Antibody [NBP2-30794] - Staining of human skin shows moderate positivity in nuclear membrane in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF10 Antibody -
BSA Free
NBP2-59679
Immunocytochemistry/Immunofluorescence: ZNF10 Antibody - BSA Free [NBP2-59679] - A431 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with ZNF10 Antibody (NBP2-59679) at 1 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: ZNF10 Antibody [NBP2-59679] - Total protein from human kidney, testis and Ntera2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-ZNF10 in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: ZNF10 Antibody [NBP2-59679] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human kidney tissue section with ZNF10 antibody at 1:500 dilution. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin. This ZNF10 antibody generated primarily a cytoplasmic staining with some nuclear positivity in all the cells of tubular epithelium. The staining was observed to be relatively stronger on the lumen side of the tubules. The cytoplasmic signal is potentially arising from the newly translated pool of this transcription factor.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF14 Antibody
NBP2-13552
Immunohistochemistry-Paraffin: ZNF14 Antibody [NBP2-13552] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.
Immunocytochemistry/Immunofluorescence: ZNF14 Antibody [NBP2-13552] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, cytosol & centrosome.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF18 Antibody
NBP1-81758
Western Blot: ZNF18 Antibody [NBP1-81758] - Analysis in control (vector only transfected HEK293T lysate) and ZNF18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ZNF18 Antibody [NBP1-81758] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane, cytosol & the Golgi apparatus.
Immunohistochemistry: ZNF18 Antibody [NBP1-81758] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF19 Antibody
NBP2-56078
Immunohistochemistry-Paraffin: ZNF19 Antibody [NBP2-56078] - Staining of human cervix, uterine shows strong nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ZNF19 Antibody [NBP2-56078] - Staining of human cell line MCF7 shows localization to mitochondria.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF20 Antibody
NBP2-93053
Immunohistochemistry-Paraffin: ZNF20 Antibody [NBP2-93053] - Paraffin-embedded human brain cancer using ZNF20 .
Western Blot: ZNF20 Antibody [NBP2-93053] - Analysis of extracts of various cell lines, using ZNF20 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.
Immunohistochemistry-Paraffin: ZNF20 Antibody [NBP2-93053] - Paraffin-embedded human kidney cancer using ZNF20 .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
ZNF28 GST (N-Term) Pr ...
H00007576-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
ZNF501 Antibody
NBP2-21020
Immunocytochemistry/Immunofluorescence: ZNF501 Antibody [NBP2-21020] - ZNF501 antibody detects ZNF501 protein at nucleus by immunofluorescent analysis.Sample: U87-MG cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: ZNF501 protein stained by ZNF501 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: ZNF501 Antibody [NBP2-21020] - Sample (30 ug of whole cell lysate) A: U87-MG 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ZNF501 Antibody [NBP2-21020] - Immunohistochemical analysis of paraffin-embedded OVCA, using antibody at 1:250 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF197 Antibody
NBP2-30999
Immunohistochemistry: ZNF197 Antibody [NBP2-30999] - Staining of human salivary gland shows strong positivity in myoepithelium.
Immunocytochemistry/Immunofluorescence: ZNF197 Antibody [NBP2-30999] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF235 Antibody
NBP1-92619
Immunocytochemistry/Immunofluorescence: ZNF235 Antibody [NBP1-92619] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF235 Antibody [NBP1-92619] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF121 Antibody
NBP1-79350
Western Blot: ZNF121 Antibody [NBP1-79350] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
ZNF763 Antibody
NBP2-94730
Western Blot: ZNF763 Antibody [NBP2-94730] - Analysis of extracts of various cell lines, using ZNF763 . Exposure time: 30s.
Western Blot: ZNF763 Antibody [NBP2-94730] - Analysis of extracts of various cell lines, using ZNF763 . Exposure time: 10s.
Species: Hu, Mu
Applications: WB
ZNF436 Antibody
NBP1-82897
Immunocytochemistry/Immunofluorescence: ZNF436 Antibody [NBP1-82897] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining in human cerebral cortex and pancreas tissues using anti-ZNF436 antibody. Corresponding ZNF436 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GTF3A Antibody
NBP1-89064
Immunocytochemistry/Immunofluorescence: GTF3A Antibody [NBP1-89064] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GTF3A Antibody [NBP1-89064] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: GTF3A Antibody [NBP1-89064] - Staining of human breast shows moderate nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF569 Antibody
NBP2-30747
Immunohistochemistry-Paraffin: ZNF569 Antibody [NBP2-30747] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: ZNF569 Antibody [NBP2-30747] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, the Golgi apparatus & vesicles. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF44 Antibody
(4E2)
H00051710-M01
Western Blot: ZNF44 Antibody (4E2) [H00051710-M01] - analysis of ZNF44 expression in transfected 293T cell line by ZNF44 monoclonal antibody (M01), clone 4E2. Lane 1: ZNF44 transfected lysate (17.5 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: ZNF44 Antibody (4E2) [H00051710-M01] - Analysis of monoclonal antibody to ZNF44 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Sandwich ELISA: ZNF44 Antibody (4E2) [H00051710-M01] - Detection limit for recombinant GST tagged ZNF44 is 0.3 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
PAK6 Antibody
AF4265
Western blot shows lysates of HT-29 human colon adenocarcinoma cell line, A431 human epithelial carcinoma cell line, KG-1 human acute myelogenous leukemia cell line, and CH-1 mouse B cell lymphoma cell line. PVDF membrane was probed with 2 µg/mL of Human/Mouse/Rat PAK6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4265) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for PAK6 at approximately 75 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 3.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(29 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for ZNF45 Antibody (NBP2-86491) (0)

There are no publications for ZNF45 Antibody (NBP2-86491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF45 Antibody (NBP2-86491) (0)

There are no reviews for ZNF45 Antibody (NBP2-86491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF45 Antibody (NBP2-86491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF45 Products

Bioinformatics Tool for ZNF45 Antibody (NBP2-86491)

Discover related pathways, diseases and genes to ZNF45 Antibody (NBP2-86491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF45 Antibody (NBP2-86491)

Discover more about diseases related to ZNF45 Antibody (NBP2-86491).
 

Pathways for ZNF45 Antibody (NBP2-86491)

View related products by pathway.

PTMs for ZNF45 Antibody (NBP2-86491)

Learn more about PTMs related to ZNF45 Antibody (NBP2-86491).

Blogs on ZNF45

There are no specific blogs for ZNF45, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF45 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF45