ZNF3 Antibody - BSA Free

Western Blot: ZNF3 Antibody [NBP2-86471] - WB Suggested Anti-ZNF3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle

Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP2-86471] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Nuclear in hepatocytes, moderate signal, low tissue distribution. Primary Antibody Concentration: 1:100.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF3. Peptide sequence: METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQEL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF3 Antibody - BSA Free

• FLJ12827
• PFM14
• PR domain zinc finger protein 17
• PRDM17
• zinc finger protein 408

Background

ZNF3 is involved in cell differentiation and/or proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF3