ZNF297B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF297B Antibody [NBP1-92621] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: ZNF297B Antibody [NBP1-92621] - Staining of human testis shows strong nuclear positivity in basal cells of ductus seminiferus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF297B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGL
Specificity
Specificity of human ZNF297B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF297B Protein (NBP1-92621PEP)
Publications
Read Publication using NBP1-92621.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF297B Antibody

  • KIAA0414
  • ZBTB22BZNF-X
  • zinc finger and BTB domain containing 43
  • Zinc finger and BTB domain-containing protein 22B
  • zinc finger and BTB domain-containing protein 43
  • Zinc finger protein 297BFLJ22470
  • ZNF297B
  • ZnF-x

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009278-B01P
Species: Hu
Applications: WB, ICC/IF
H00026469-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
H00026469-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92621
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF297B Antibody (NBP1-92621)(1)

Reviews for ZNF297B Antibody (NBP1-92621) (0)

There are no reviews for ZNF297B Antibody (NBP1-92621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF297B Antibody (NBP1-92621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF297B Products

Bioinformatics Tool for ZNF297B Antibody (NBP1-92621)

Discover related pathways, diseases and genes to ZNF297B Antibody (NBP1-92621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF297B

There are no specific blogs for ZNF297B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF297B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB43