Home » ZNF23 » ZNF23 Antibodies » ZNF23 Antibody (2D3)

ZNF23 Antibody (2D3)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZNF23 Antibody (2D3) [H00007571-M02] - Analysis of ZNF23 expression in transfected 293T cell line by ZNF23 monoclonal antibody (M02), clone 2D3.Lane 1: ZNF23 transfected lysate (Predicted MW: 73.1 KDa).Lane 2: Non-transfected lysate.
Western Blot: ZNF23 Antibody (2D3) [H00007571-M02] - Analysis of ZNF23 expression in transfected 293T cell line by ZNF23 monoclonal antibody (M02), clone 2D3.Lane 1: ZNF23 transfected lysate (Predicted MW: 73.1 ...read more
Sandwich ELISA: ZNF23 Antibody (2D3) [H00007571-M02] - Detection limit for recombinant GST tagged ZNF23 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZNF23 Antibody (2D3) Summary

Immunogen
ZNF23 (NP_666016.1, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP
Specificity
ZNF23 - zinc finger protein 23 (KOX 16) (2D3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF23
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF23 Antibody (2D3)

  • FLJ45745
  • MGC2555
  • NOLZ-1
  • zinc finger protein 503

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZNF19 Antibody
NBP2-56078
Immunohistochemistry-Paraffin: ZNF19 Antibody [NBP2-56078] - Staining of human cervix, uterine shows strong nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ZNF19 Antibody [NBP2-56078] - Staining of human cell line MCF7 shows localization to mitochondria.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF32 Antibody
H00007580-B01P
Western Blot: ZNF32 Antibody [H00007580-B01P] - Analysis of ZNF32 expression in transfected 293T cell line by ZNF32 polyclonal antibody. Lane 1: ZNF32 transfected lysate(30.03 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ZNF32 Antibody [H00007580-B01P] - Analysis of purified antibody to ZNF32 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell . Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Nox4 Antibody -
BSA Free
NB110-58849
Knockdown Validated: Nox4 Antibody [NB110-58849] - Silencing of NOX4 in H4-II-C3 rat hepatoma cell line. Image from verified customer review.
Immunohistochemistry: Nox4 Antibody [NB110-58849] - AT1-KO mice are resistant to alcohol-induced oxidative stress. Oxidative stress was examined by immunohistochemical staining of NOX4 (D) expression was examined by immunohistochemical staining. Data are presented as means +/- SD. *, P < 0.05 vs corresponding control; #, P < 0.05 vs WT alcohol group. Bar = 50 uM. Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1111/j.1582-4934.2012.01569.x), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Nox4 Antibody [NB110-58849] - Porcine aortic endothelial cells stained with NB110-58849 (green). Nuclei were counterstained with DAPI (blue). Image from verified customer review.
(8 Reviews)
(94 Publications)
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
alpha-2A
Adrenergic R/ADRA2A A
NBP2-22452
Western Blot: alpha-2A Adrenergic R/ADRA2A Antibody [NBP2-22452] - Analysis was performed on whole cell extracts (30 ug lysate) of PC-3 (Lane 1), HEK-293 (Lane 2), T47D (Lane 3) and HEL 92.1.7 (lane 4). The blots were probed with Anti-alpha-2a Adrenergic Receptor Rabbit Polyclonal Antibody.
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ZNF475 Antibody
NBP2-86497
Immunohistochemistry-Paraffin: ZNF475 Antibody [NBP2-86497] - Rabbit Anti-ZFP1 Antibody. Paraffin Embedded Tissue: Human Intestine. Cellular Data: Epithelial cells of intestinal villas. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Western Blot: ZNF475 Antibody [NBP2-86497] - WB Suggested Anti-ZFP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: ZNF475 Antibody [NBP2-86497] - Rabbit Anti-ZFP1 Antibody. Paraffin Embedded Tissue: Human Spermatophore. Cellular Data: Epithelial cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Species: Hu
Applications: IHC, IHC-P, WB
LPCAT1 Antibody
NBP1-88923
Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein distribution across tissues to independent antibody NBP1-88922 (B).
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in human breast carcinoma at 1:2000. Formalin-fixed, paraffin-embedded tissue section from invasive ductal carcinoma. An organellar/mitochondrial pattern of Bcl-xL staining is observed in the cytosol of tumor cells.
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-xL at ~30 kDa.
(1 Review)
(2 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
FRA10AC1 Antibody
NBP2-16528
Western Blot: FRA10AC1 Antibody [NBP2-16528] - Sample (30 ug of whole cell lysate) A: HeLa nucleus 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: FRA10AC1 Antibody [NBP2-16528] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: C10orf4 protein stained by C10orf4 antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu
Applications: ICC/IF, WB
ZFP28 Antibody
NBP1-81408
Immunocytochemistry/Immunofluorescence: ZFP28 Antibody [NBP1-81408] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZFP28 Antibody [NBP1-81408] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Recombinant Human
LPCAT3 GST (N-Term) P ...
H00010162-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
26S proteasome
subunit 9 Antibody
NBP2-47561
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney, liver, skin and testis using Anti-PSMD9 antibody NBP2-47561 (A) shows similar protein distribution across tissues to independent antibody NBP2-47560(B).
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human liver using Anti-PSMD9 antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACSL3 Antibody
NBP2-15252
Simple Western: ACSL3 Antibody [NBP2-15252] - Mouse brain (hippocampus) tissue. Simple Western image submitted by a verified customer review.
Western Blot: ACSL3 Antibody [NBP2-15252] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ACSL3 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP2-15252] - IHC analysis of human breast cancer tissue section, using ACSL3 antibody at 1:500 dilution. Antigen Retrieval: Trilogy(TM) (EDTA based, pH 8.0) buffer for 15 min.
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Dynactin 6 Antibody
NBP1-80616
Immunohistochemistry-Paraffin: Dynactin 6 Antibody [NBP1-80616] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SSSCA1 Antibody
(OTI2F5) - Azide and ...
NBP2-74359
Western Blot: SSSCA1 Antibody (OTI2F5) - Azide and BSA Free [NBP2-74359] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SSSCA1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SSSCA1.
Flow Cytometry: SSSCA1 Antibody (OTI2F5) - Azide and BSA Free [NBP2-74359] - Analysis of Hela cells, using anti-SSSCA1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SSSCA1 Antibody (OTI2F5) - Azide and BSA Free [NBP2-74359] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-SSSCA1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
IFI27 Antibody
H00003429-A01
Western Blot: IFI27 Antibody [H00003429-A01] - Detection against Immunogen (39.2 KDa) .
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB

Publications for ZNF23 Antibody (H00007571-M02) (0)

There are no publications for ZNF23 Antibody (H00007571-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF23 Antibody (H00007571-M02) (0)

There are no reviews for ZNF23 Antibody (H00007571-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF23 Antibody (H00007571-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF23 Products

Bioinformatics Tool for ZNF23 Antibody (H00007571-M02)

Discover related pathways, diseases and genes to ZNF23 Antibody (H00007571-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF23 Antibody (H00007571-M02)

Discover more about diseases related to ZNF23 Antibody (H00007571-M02).
 

Pathways for ZNF23 Antibody (H00007571-M02)

View related products by pathway.

Research Areas for ZNF23 Antibody (H00007571-M02)

Find related products by research area.

Blogs on ZNF23

There are no specific blogs for ZNF23, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF23 Antibody (2D3) and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF23
Entrez
Uniprot