![Western Blot: ZNF18 Antibody (2A4) [H00007566-M01] - Analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody (M01), clone 2A4.Lane 1: ZNF18 transfected lysate(62.3 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZNF18-Antibody-2A4-Western-Blot-H00007566-M01-img0003.jpg "Western Blot: ZNF18 Antibody (2A4) [H00007566-M01] - Analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody (M01), clone 2A4.Lane 1: ZNF18 transfected lysate(62.3 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2A4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ZNF18 (NP_653281, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG |
| Specificity | ZNF18 - zinc finger protein 18 (KOX 11) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ZNF18 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: ZNF18 Antibody (2A4) [H00007566-M01] - Detection limit for recombinant GST tagged ZNF18 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ZNF18-Antibody-2A4-Sandwich-ELISA-H00007566-M01-img0002.jpg "Sandwich ELISA: ZNF18 Antibody (2A4) [H00007566-M01] - Detection limit for recombinant GST tagged ZNF18 is 1 ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")