Home » ZNF18 » ZNF18 Antibodies » ZNF18 Antibody (2A4)

ZNF18 Antibody (2A4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZNF18 Antibody (2A4) [H00007566-M01] - Analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody (M01), clone 2A4.Lane 1: ZNF18 transfected lysate(62.3 KDa).Lane 2: Non-transfected lysate.
Western Blot: ZNF18 Antibody (2A4) [H00007566-M01] - Analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody (M01), clone 2A4.Lane 1: ZNF18 transfected lysate(62.3 KDa).Lane 2: ...read more
Sandwich ELISA: ZNF18 Antibody (2A4) [H00007566-M01] - Detection limit for recombinant GST tagged ZNF18 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZNF18 Antibody (2A4) Summary

Immunogen
ZNF18 (NP_653281, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG
Specificity
ZNF18 - zinc finger protein 18 (KOX 11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF18 Antibody (2A4)

  • HDSG1Zinc finger protein 535
  • heart development-specific protein
  • KOX11Heart development-specific gene 1 protein
  • Zfp535
  • zinc finger protein 18 (KOX 11)
  • zinc finger protein 18
  • ZKSCAN6Zinc finger protein KOX11
  • ZNF535Zinc finger protein with KRAB and SCAN domains 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZNF45 Antibody
NBP1-32382
Western Blot: ZNF45 Antibody [NBP1-32382] - Sample(30 ug of whole cell lysate)A:293T7. 5% SDS PAGE, antibody diluted at 1:2000.
Immunocytochemistry/Immunofluorescence: ZNF45 Antibody [NBP1-32382] - HCT116 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: ZNF45 protein stained by ZNF45 antibody [N2C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Immunocytochemistry/Immunofluorescence: ZNF45 Antibody [NBP1-32382] - A375 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: ZNF45 protein stained by ZNF45 antibody [N2C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF30 Antibody
NBP1-84108
Immunohistochemistry-Paraffin: ZNF30 Antibody [NBP1-84108] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunocytochemistry/Immunofluorescence: ZNF30 Antibody [NBP1-84108] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF224 Antibody
NBP2-30794
Immunohistochemistry-Paraffin: ZNF224 Antibody [NBP2-30794] - Staining of human prostate shows weak positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: ZNF224 Antibody [NBP2-30794] - Staining of human kidney shows moderate nuclear positivity in cells in tubules, as well as moderate nuclear membrane positivity in glomeruli cells.
Immunohistochemistry-Paraffin: ZNF224 Antibody [NBP2-30794] - Staining of human skin shows moderate positivity in nuclear membrane in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF10 Antibody -
BSA Free
NBP2-59679
Immunocytochemistry/Immunofluorescence: ZNF10 Antibody - BSA Free [NBP2-59679] - A431 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with ZNF10 Antibody (NBP2-59679) at 1 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: ZNF10 Antibody [NBP2-59679] - Total protein from human kidney, testis and Ntera2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-ZNF10 in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: ZNF10 Antibody [NBP2-59679] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human kidney tissue section with ZNF10 antibody at 1:500 dilution. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin. This ZNF10 antibody generated primarily a cytoplasmic staining with some nuclear positivity in all the cells of tubular epithelium. The staining was observed to be relatively stronger on the lumen side of the tubules. The cytoplasmic signal is potentially arising from the newly translated pool of this transcription factor.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF14 Antibody
NBP2-13552
Immunohistochemistry-Paraffin: ZNF14 Antibody [NBP2-13552] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.
Immunocytochemistry/Immunofluorescence: ZNF14 Antibody [NBP2-13552] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, cytosol & centrosome.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF19 Antibody
NBP2-56078
Immunohistochemistry-Paraffin: ZNF19 Antibody [NBP2-56078] - Staining of human cervix, uterine shows strong nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ZNF19 Antibody [NBP2-56078] - Staining of human cell line MCF7 shows localization to mitochondria.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF20 Antibody
NBP2-93053
Immunohistochemistry-Paraffin: ZNF20 Antibody [NBP2-93053] - Paraffin-embedded human brain cancer using ZNF20 .
Western Blot: ZNF20 Antibody [NBP2-93053] - Analysis of extracts of various cell lines, using ZNF20 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.
Immunohistochemistry-Paraffin: ZNF20 Antibody [NBP2-93053] - Paraffin-embedded human kidney cancer using ZNF20 .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
ZNF28 GST (N-Term) Pr ...
H00007576-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
ZNF197 Antibody
NBP2-30999
Immunohistochemistry: ZNF197 Antibody [NBP2-30999] - Staining of human salivary gland shows strong positivity in myoepithelium.
Immunocytochemistry/Immunofluorescence: ZNF197 Antibody [NBP2-30999] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF121 Antibody
NBP1-79350
Western Blot: ZNF121 Antibody [NBP1-79350] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
KOX2 Antibody
NBP1-79449
Western Blot: KOX2 Antibody [NBP1-79449] - Hela cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
HIC1 Antibody
(4E11)
H00003090-M01
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11 Analysis of HIC1 expression in Jurkat.
Immunocytochemistry/Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01] - Analysis of monoclonal antibody to HIC1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: HIC1 Antibody (4E11) [H00003090-M01] - Detection limit for recombinant GST tagged HIC1 is approximately 0.1ng/ml as a capture antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Aldehyde
Dehydrogenase 3-A1/AL ...
NBP2-02483
Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (OTI1B6) [NBP2-02483] - Analysis of extracts (10ug) from 2 different cell lines by using anti-ALDH3A1 monoclonal antibody at 1:200 dilution.
Flow Cytometry: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (OTI1B6) [NBP2-02483] - HEK293T cells transfected with either pCMV6-ENTRY ALDH3A1.(Red) or empty vector control plasmid (Blue) were immunostained with anti-ALDH3A1 mouse monoclonal, and then analyzed by flow cytometry.
Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (OTI1B6) [NBP2-02483] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ALDH3A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ALDH3A1.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
OVCA2 Antibody
NBP2-15058
Immunohistochemistry-Paraffin: OVCA2 Antibody [NBP2-15058] - Paraffin-embedded BT483 xenograft, using antibody at 1:500 dilution.
Western Blot: OVCA2 Antibody [NBP2-15058] - Sample (30 ug of whole cell lysate) A: Raji 12% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
Clathrin Heavy
Chain 2/CHC22/CLTCL1 ...
AF6948
Western blot shows lysates of human testis tissue and U2OS human osteosarcoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Clathrin Heavy Chain 2/CHC22 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6948) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Clathrin Heavy Chain 2/CHC22 at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Clathrin Heavy Chain 2/CHC22 was detected in immersion fixed human mesenchymal stem cells differentiated to adipocytes with Human/Mouse/Rat StemXVivo Adipogenic Supplement (Catalog # CCM011) using Sheep Anti-Human Clathrin Heavy Chain 2/CHC22 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6948) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: ICC, WB
FALDH Antibody
(OTI2A7)
NBP2-01017
Flow Cytometry: FALDH Antibody (2A7) [NBP2-01017] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-FALDH antibody, and then analyzed by flow cytometry.
Western Blot: FALDH Antibody (2A7) [NBP2-01017] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FALDH (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FALDH.
Immunohistochemistry-Paraffin: FALDH Antibody (2A7) [NBP2-01017] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-FALDH mouse monoclonal antibody.
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, WB
UBE3B Antibody
NBP1-92559
Immunocytochemistry/Immunofluorescence: UBE3B Antibody [NBP1-92559] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human kidney shows strong positivity in cytoplasm in cells in tubules.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NCKAP5L Antibody
NBP1-93583
Immunohistochemistry-Paraffin: NCKAP5L Antibody [NBP1-93583] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Immunocytochemistry/Immunofluorescence: NCKAP5L Antibody [NBP1-93583] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Western Blot: NCKAP5L Antibody [NBP1-93583] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
OVCA1 Antibody
NBP1-56693
Western Blot: OVCA1 Antibody [NBP1-56693] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: OVCA1 Antibody [NBP1-56693] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ZNF18 Antibody (H00007566-M01) (0)

There are no publications for ZNF18 Antibody (H00007566-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF18 Antibody (H00007566-M01) (0)

There are no reviews for ZNF18 Antibody (H00007566-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF18 Antibody (H00007566-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF18 Products

Bioinformatics Tool for ZNF18 Antibody (H00007566-M01)

Discover related pathways, diseases and genes to ZNF18 Antibody (H00007566-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF18 Antibody (H00007566-M01)

Discover more about diseases related to ZNF18 Antibody (H00007566-M01).
 

Pathways for ZNF18 Antibody (H00007566-M01)

View related products by pathway.

Blogs on ZNF18

There are no specific blogs for ZNF18, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF18 Antibody (2A4) and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF18
Entrez
OMIM
Uniprot