ZNF18 Antibody (2A4)

Images

 
Western Blot: ZNF18 Antibody (2A4) [H00007566-M01] - Analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody (M01), clone 2A4.Lane 1: ZNF18 transfected lysate(62.3 KDa).Lane 2: ...read more
Sandwich ELISA: ZNF18 Antibody (2A4) [H00007566-M01] - Detection limit for recombinant GST tagged ZNF18 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF18 Antibody (2A4) Summary

Immunogen
ZNF18 (NP_653281, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG
Specificity
ZNF18 - zinc finger protein 18 (KOX 11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF18 Antibody (2A4)

  • HDSG1Zinc finger protein 535
  • heart development-specific protein
  • KOX11Heart development-specific gene 1 protein
  • Zfp535
  • zinc finger protein 18 (KOX 11)
  • zinc finger protein 18
  • ZKSCAN6Zinc finger protein KOX11
  • ZNF535Zinc finger protein with KRAB and SCAN domains 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32382
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59679
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13552
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93053
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007576-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79350
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-79449
Species: Hu
Applications: WB
H00003090-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-02483
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15058
Species: Hu
Applications: IHC, IHC-P, WB
AF6948
Species: Hu
Applications: ICC, WB
NBP2-01017
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-92559
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-93583
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-56693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ZNF18 Antibody (H00007566-M01) (0)

There are no publications for ZNF18 Antibody (H00007566-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF18 Antibody (H00007566-M01) (0)

There are no reviews for ZNF18 Antibody (H00007566-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF18 Antibody (H00007566-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF18 Products

Bioinformatics Tool for ZNF18 Antibody (H00007566-M01)

Discover related pathways, diseases and genes to ZNF18 Antibody (H00007566-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF18 Antibody (H00007566-M01)

Discover more about diseases related to ZNF18 Antibody (H00007566-M01).
 

Pathways for ZNF18 Antibody (H00007566-M01)

View related products by pathway.

Blogs on ZNF18

There are no specific blogs for ZNF18, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF18 Antibody (2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF18
Entrez
OMIM
Uniprot