ZNF154 Antibody (6G11)

Images

 
Sandwich ELISA: ZNF154 Antibody (6G11) [H00007710-M01] - Detection limit for recombinant GST tagged ZNF154 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF154 Antibody (6G11) Summary

Immunogen
ZNF154 (NP_003435, 1 a.a. - 98 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAVATLRTPTQGTVTFEDVAVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDF
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF154
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF154 Antibody (6G11)

  • KIAA2003
  • MGC176628
  • MGC176661
  • pHZ-92
  • zinc finger protein 154

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-90646
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-56958
Species: Hu
Applications: ICC/IF
NB200-142
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-86699
Species: Hu
Applications: IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84170
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6539
Species: Hu
Applications: WB, IHC
H00007710-M01
Species: Hu
Applications: WB, ELISA

Publications for ZNF154 Antibody (H00007710-M01) (0)

There are no publications for ZNF154 Antibody (H00007710-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF154 Antibody (H00007710-M01) (0)

There are no reviews for ZNF154 Antibody (H00007710-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF154 Antibody (H00007710-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF154 Products

Bioinformatics Tool for ZNF154 Antibody (H00007710-M01)

Discover related pathways, diseases and genes to ZNF154 Antibody (H00007710-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF154 Antibody (H00007710-M01)

Discover more about diseases related to ZNF154 Antibody (H00007710-M01).
 

Pathways for ZNF154 Antibody (H00007710-M01)

View related products by pathway.

PTMs for ZNF154 Antibody (H00007710-M01)

Learn more about PTMs related to ZNF154 Antibody (H00007710-M01).

Blogs on ZNF154

There are no specific blogs for ZNF154, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF154 Antibody (6G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF154