PCDHAC1 Antibody

Images

 
Western Blot: PCDHAC1 Antibody [NBP1-59214] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCDHAC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCDHAC1(protocadherin alpha subfamily C, 1) The peptide sequence was selected from the N terminal of PCDHAC1. Peptide sequence RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (90%), Equine (90%), Zebrafish (90%), Guinea Pig (92%), Bovine (90%), Rabbit (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PCDHAC1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCDHAC1 Antibody

  • PCDH-ALPHA-C1
  • protocadherin alpha subfamily C, 1
  • protocadherin alpha-C1

Background

PCDHAC1 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90646
Species: Hu
Applications: IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB200-142
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-92641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-84170
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-87428
Species: Hu
Applications: WB
AF6539
Species: Hu
Applications: WB, IHC
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-92394
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-95244
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31842
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready

Publications for PCDHAC1 Antibody (NBP1-59214) (0)

There are no publications for PCDHAC1 Antibody (NBP1-59214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHAC1 Antibody (NBP1-59214) (0)

There are no reviews for PCDHAC1 Antibody (NBP1-59214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHAC1 Antibody (NBP1-59214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PCDHAC1 Products

Bioinformatics Tool for PCDHAC1 Antibody (NBP1-59214)

Discover related pathways, diseases and genes to PCDHAC1 Antibody (NBP1-59214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHAC1 Antibody (NBP1-59214)

Discover more about diseases related to PCDHAC1 Antibody (NBP1-59214).
 

Pathways for PCDHAC1 Antibody (NBP1-59214)

View related products by pathway.

PTMs for PCDHAC1 Antibody (NBP1-59214)

Learn more about PTMs related to PCDHAC1 Antibody (NBP1-59214).

Blogs on PCDHAC1

There are no specific blogs for PCDHAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDHAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHAC1
Uniprot