ZNF14 Antibody

Images

 
Western Blot: ZNF14 Antibody [NBP2-86437] - Host: Rabbit. Target Name: ZNF658B. Sample Type: Breast Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF14 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF14. Peptide sequence: IECGKTFSKTSHLRAHQRIHTGEKPYECVECEKTFSHKTHLSVHQRVHTG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF14 Antibody

  • GIOT4
  • GIOT-4gonadotropin inducible transcription repressor-4
  • Gonadotropin-inducible ovary transcription repressor 4
  • KOX6Zinc finger protein KOX6
  • zinc finger protein 14 (KOX 6)
  • zinc finger protein 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32382
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59679
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81758
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-56078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93053
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007576-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79350
Species: Hu
Applications: WB
NBP1-79449
Species: Hu
Applications: WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP3-09940
Species: Hu
Applications: WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-43651
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-86437
Species: Hu
Applications: WB

Publications for ZNF14 Antibody (NBP2-86437) (0)

There are no publications for ZNF14 Antibody (NBP2-86437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF14 Antibody (NBP2-86437) (0)

There are no reviews for ZNF14 Antibody (NBP2-86437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF14 Antibody (NBP2-86437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF14 Products

Array NBP2-86437

Bioinformatics Tool for ZNF14 Antibody (NBP2-86437)

Discover related pathways, diseases and genes to ZNF14 Antibody (NBP2-86437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF14 Antibody (NBP2-86437)

Discover more about diseases related to ZNF14 Antibody (NBP2-86437).
 

Pathways for ZNF14 Antibody (NBP2-86437)

View related products by pathway.

Blogs on ZNF14

There are no specific blogs for ZNF14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF14