ZMAT4 Antibody

Images

 
Western Blot: ZMAT4 Antibody [H00079698-B01P] - Analysis of ZMAT4 expression in transfected 293T cell line by ZMAT4 polyclonal antibody. Lane 1: ZMAT4 transfected lysate(16.83 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZMAT4 Antibody Summary

Immunogen
ZMAT4 (AAH19598.1, 1 a.a. - 153 a.a.) full-length human protein. MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZMAT4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZMAT4 Antibody

  • FLJ13842
  • zinc finger matrin-type protein 4
  • zinc finger, matrin type 4
  • zinc finger, matrin-type 4

Background

ZMAT4, also known as Zinc finger matrin-type protein 4, has a 229 amino acid long isoform that is 26 kDa and a short 153 amino acid isoform that is approx. 17 kDa. This protein commonly found in the nucleus, is related to DNA binding, metal ion binding and zinc ion binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZMAT4 Antibody (H00079698-B01P) (0)

There are no publications for ZMAT4 Antibody (H00079698-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMAT4 Antibody (H00079698-B01P) (0)

There are no reviews for ZMAT4 Antibody (H00079698-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMAT4 Antibody (H00079698-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZMAT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMAT4
Uniprot