ZMAT4 Antibody - Azide and BSA Free Summary
| Immunogen |
ZMAT4 (AAH19598.1, 1 a.a. - 153 a.a.) full-length human protein. MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
ZMAT4 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ZMAT4 Antibody - Azide and BSA Free
Background
ZMAT4, also known as Zinc finger matrin-type protein 4, has a 229 amino acid long isoform that is 26 kDa and a short 153 amino acid isoform that is approx. 17 kDa. This protein commonly found in the nucleus, is related to DNA binding, metal ion binding and zinc ion binding.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: WB
Publications for ZMAT4 Antibody (H00079698-B01P) (0)
There are no publications for ZMAT4 Antibody (H00079698-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZMAT4 Antibody (H00079698-B01P) (0)
There are no reviews for ZMAT4 Antibody (H00079698-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZMAT4 Antibody (H00079698-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZMAT4 Products
Blogs on ZMAT4