ZG16 Antibody

Images

 
Western Blot: ZG16 Antibody [NBP1-58007] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZG16 Antibody Summary

Immunogen
Synthetic peptides corresponding to ZG16(zymogen granule protein 16) The peptide sequence was selected from the middle region of ZG16. Peptide sequence WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZG16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ZG16 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZG16 Antibody

  • hZG16
  • JCLN
  • JCLN1
  • MGC34820
  • ZG16A

Background

ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7777
Species: Hu
Applications: WB, IHC
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-58007
Species: Hu
Applications: WB

Publications for ZG16 Antibody (NBP1-58007) (0)

There are no publications for ZG16 Antibody (NBP1-58007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZG16 Antibody (NBP1-58007) (0)

There are no reviews for ZG16 Antibody (NBP1-58007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZG16 Antibody (NBP1-58007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZG16 Products

Bioinformatics Tool for ZG16 Antibody (NBP1-58007)

Discover related pathways, diseases and genes to ZG16 Antibody (NBP1-58007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZG16 Antibody (NBP1-58007)

Discover more about diseases related to ZG16 Antibody (NBP1-58007).
 

Pathways for ZG16 Antibody (NBP1-58007)

View related products by pathway.

Blogs on ZG16

There are no specific blogs for ZG16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZG16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZG16
Uniprot