Recombinant Human ZFYVE19 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZFYVE19 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 396 of Human ZFYVE19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ZFYVE19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
69.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFYVE19 GST (N-Term) Protein

  • FLJ14840
  • MLL partner containing FYVE domain
  • MPFYVE
  • zinc finger FYVE domain-containing protein 19
  • zinc finger, FYVE domain containing 19

Background

ZFYVE19( AAH15738, 1 a.a. - 397 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2586
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-32426
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-03374
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
E-327
Species: Hu
Applications: BA
NB110-60512
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89785
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DYC1663-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-82785
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-83906
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83826
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86680
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45763
Species: Hu, Mu
Applications: IHC, WB
NBP1-92012
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003304-M02
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P, PLA, WB
H00084936-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZFYVE19 Recombinant Protein (H00084936-P01) (0)

There are no publications for ZFYVE19 Recombinant Protein (H00084936-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE19 Recombinant Protein (H00084936-P01) (0)

There are no reviews for ZFYVE19 Recombinant Protein (H00084936-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFYVE19 Recombinant Protein (H00084936-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFYVE19 Products

Bioinformatics Tool for ZFYVE19 Recombinant Protein (H00084936-P01)

Discover related pathways, diseases and genes to ZFYVE19 Recombinant Protein (H00084936-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFYVE19 Recombinant Protein (H00084936-P01)

Discover more about diseases related to ZFYVE19 Recombinant Protein (H00084936-P01).
 

Pathways for ZFYVE19 Recombinant Protein (H00084936-P01)

View related products by pathway.

Blogs on ZFYVE19

There are no specific blogs for ZFYVE19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFYVE19 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFYVE19