ZFP106 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ZFP106 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFP106.
  
  

  Source: E. coli

  Amino Acid Sequence: RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDWNHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSVRSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEGFTSD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ZFP106
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13543.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZFP106 Recombinant Protein Antigen

• DKFZp451A239
• FLJ34610
• SH3BP3
• SH3-domain binding protein 3
• zfp-106
• zinc finger protein 106 homolog (mouse)
• zinc finger protein 106 homolog
• Zinc finger protein 474
• ZNF474FLJ45841

Background

Zinc finger protein homolog 106 (ZFP106) is a C2H2-type zinc finger protein that also contains 2 WD repeats. ZFP106 is highly expressed in striated muscle, brown fat, and developing brain and is regulated by myogenin and nuclear respiratory factor-1 (NRF-1). ZFP106 localizes to the nucleus in association with nucleolar transcriptional machinery. The WD40 repeat in ZFP106 appears to facilitate targeting of ZFP106 to the nucleolus and to mediate the interaction between ZFP106 and testis-specific gene 118 (TSF118). A two-hybrid screen has identified testis-specific Y-encoded-like protein (TSPYL) as a ZFP106 interacting protein. These data suggest an important role for ZFP106 in testis development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ZFP106