ZFP106 Recombinant Protein Antigen

Images

 
There are currently no images for ZFP106 Protein (NBP2-13543PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZFP106 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFP106.

Source: E. coli

Amino Acid Sequence: RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDWNHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSVRSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEGFTSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZFP106
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13543. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZFP106 Recombinant Protein Antigen

  • DKFZp451A239
  • FLJ34610
  • SH3BP3
  • SH3-domain binding protein 3
  • zfp-106
  • zinc finger protein 106 homolog (mouse)
  • zinc finger protein 106 homolog
  • Zinc finger protein 474
  • ZNF474FLJ45841

Background

Zinc finger protein homolog 106 (ZFP106) is a C2H2-type zinc finger protein that also contains 2 WD repeats. ZFP106 is highly expressed in striated muscle, brown fat, and developing brain and is regulated by myogenin and nuclear respiratory factor-1 (NRF-1). ZFP106 localizes to the nucleus in association with nucleolar transcriptional machinery. The WD40 repeat in ZFP106 appears to facilitate targeting of ZFP106 to the nucleolus and to mediate the interaction between ZFP106 and testis-specific gene 118 (TSF118). A two-hybrid screen has identified testis-specific Y-encoded-like protein (TSPYL) as a ZFP106 interacting protein. These data suggest an important role for ZFP106 in testis development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89125
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
MAB5306
Species: Hu, Mu, Rt
Applications: WB
MAB66861
Species: Hu
Applications: ICC, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NBP1-62583
Species: Hu
Applications: WB
1544-IR
Species: Hu
Applications: Bind
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB

Publications for ZFP106 Protein (NBP2-13543PEP) (0)

There are no publications for ZFP106 Protein (NBP2-13543PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP106 Protein (NBP2-13543PEP) (0)

There are no reviews for ZFP106 Protein (NBP2-13543PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZFP106 Protein (NBP2-13543PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFP106 Products

Array NBP2-13543PEP

Blogs on ZFP106

There are no specific blogs for ZFP106, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZFP106 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP106