ZDHHC8 Antibody (1C5) - Azide and BSA Free Summary
Immunogen |
ZDHHC8 (AAH09442, 1 a.a. ~ 42 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL |
Specificity |
ZDHHC8 (1C5) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ZDHHC8 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ZDHHC8 Antibody (1C5) - Azide and BSA Free
Background
The gene ZDHHC8, which encodes a putative palmitoyltransferase at 22q11, has been proposed as a gene which may increase liability to schizophrenia. Chromosome region 22q11 has been proposed as a major candidate locus for genes leading to susceptibility to schizophrenia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ELISA
Publications for ZDHHC8 Antibody (H00029801-M02) (0)
There are no publications for ZDHHC8 Antibody (H00029801-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZDHHC8 Antibody (H00029801-M02) (0)
There are no reviews for ZDHHC8 Antibody (H00029801-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZDHHC8 Antibody (H00029801-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZDHHC8 Products
Research Areas for ZDHHC8 Antibody (H00029801-M02)
Find related products by research area.
|
Blogs on ZDHHC8