ZDHHC8 Antibody (1C5) - Azide and BSA Free

Western Blot: ZDHHC8 Antibody (1C5) [H00029801-M02] - Analysis of ZDHHC8 expression in transfected 293T cell line by ZDHHC8 monoclonal antibody (M02), clone 1C5.Lane 1: ZDHHC8 transfected lysate (Predicted MW: 81.443 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1C5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZDHHC8 Antibody (1C5) - Azide and BSA Free Summary

• Immunogen: ZDHHC8 (AAH09442, 1 a.a. ~ 42 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
• Specificity: ZDHHC8 (1C5)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZDHHC8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZDHHC8 Antibody (1C5) - Azide and BSA Free

• DHHC8
• EC 2.3.1
• EC 2.3.1.-
• KIAA1292DHHC-8
• membrane-associated DHHC8 zinc finger protein
• probable palmitoyltransferase ZDHHC8
• ZDHHCL1
• Zinc finger DHHC domain-containing protein 8
• Zinc finger protein 378
• zinc finger, DHHC-type containing 8
• ZNF378zinc finger, DHHC domain like containing 1

Background

The gene ZDHHC8, which encodes a putative palmitoyltransferase at 22q11, has been proposed as a gene which may increase liability to schizophrenia. Chromosome region 22q11 has been proposed as a major candidate locus for genes leading to susceptibility to schizophrenia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC8
• Entrez:
  • 29801(Human)
• OMIM:
  • 608784(Human)
• Uniprot:
  • AAH09442(Human)