Recombinant Human ZDHHC7 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZDHHC7 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-208 of Human ZDHHC7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ZDHHC7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZDHHC7 GST (N-Term) Protein

  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ10792
  • FLJ20279
  • palmitoyltransferase ZDHHC7
  • Sertoli cell gene with zinc finger domain- and #946
  • SERZ1
  • SERZ-B
  • Zinc finger DHHC domain-containing protein 7
  • Zinc finger protein 370
  • zinc finger, DHHC domain containing 7
  • zinc finger, DHHC-type containing 7
  • ZNF370DHHC-7

Background

ZDHHC7( AAH17702, 1 a.a. - 209 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-57049
Species: Hu
Applications: WB
NB120-2765
Species: Bv, Ch, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-645
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-99205
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
DY262
Species: Hu
Applications: ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-94111
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-76869
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13541
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB

Publications for ZDHHC7 Recombinant Protein (H00055625-P01) (0)

There are no publications for ZDHHC7 Recombinant Protein (H00055625-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC7 Recombinant Protein (H00055625-P01) (0)

There are no reviews for ZDHHC7 Recombinant Protein (H00055625-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC7 Recombinant Protein (H00055625-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ZDHHC7 Products

Bioinformatics Tool for ZDHHC7 Recombinant Protein (H00055625-P01)

Discover related pathways, diseases and genes to ZDHHC7 Recombinant Protein (H00055625-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC7 Recombinant Protein (H00055625-P01)

Discover more about diseases related to ZDHHC7 Recombinant Protein (H00055625-P01).
 

Pathways for ZDHHC7 Recombinant Protein (H00055625-P01)

View related products by pathway.

PTMs for ZDHHC7 Recombinant Protein (H00055625-P01)

Learn more about PTMs related to ZDHHC7 Recombinant Protein (H00055625-P01).

Blogs on ZDHHC7

There are no specific blogs for ZDHHC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZDHHC7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC7