ZDHHC7 Recombinant Protein Antigen

Images

 
There are currently no images for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZDHHC7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZDHHC7.

Source: E.coli

Amino Acid Sequence: LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZDHHC7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56799 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ZDHHC7 Recombinant Protein Antigen

  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ10792
  • FLJ20279
  • palmitoyltransferase ZDHHC7
  • Sertoli cell gene with zinc finger domain- and #946
  • SERZ1
  • SERZ-B
  • Zinc finger DHHC domain-containing protein 7
  • Zinc finger protein 370
  • zinc finger, DHHC domain containing 7
  • zinc finger, DHHC-type containing 7
  • ZNF370DHHC-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57201
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49806
Species: Hu
Applications: IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00005555-P01
Species: Hu
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP1-85057
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1077
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13541
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P

Publications for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP) (0)

There are no publications for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP) (0)

There are no reviews for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZDHHC7 Products

Bioinformatics Tool for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP)

Discover related pathways, diseases and genes to ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP)

Discover more about diseases related to ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP).
 

Pathways for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP)

View related products by pathway.

PTMs for ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP)

Learn more about PTMs related to ZDHHC7 Recombinant Protein Antigen (NBP2-56799PEP).

Blogs on ZDHHC7

There are no specific blogs for ZDHHC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZDHHC7 Antibody
NBP2-32486

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZDHHC7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC7