ZBBX Antibody

Images

 
Western Blot: ZBBX Antibody [NBP2-86399] - Host: Rabbit. Target Name: ZBBX. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBBX Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBBX. Peptide sequence: QNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (92%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZBBX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBBX Antibody

  • zinc finger, B-box domain containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3067
Species: Hu, Mu
Applications: WB
NBP1-81628
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77128
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, IHC, IHC-P
AF3457
Species: Hu
Applications: WB, ICC
H00022954-M09
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, RNAi
NBP1-83656
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB110-60019
Species: Mu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC
AF5085
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-59195
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-91003
Species: Hu, Tr
Applications: IHC, IHC-P
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZBBX Antibody (NBP2-86399) (0)

There are no publications for ZBBX Antibody (NBP2-86399).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBBX Antibody (NBP2-86399) (0)

There are no reviews for ZBBX Antibody (NBP2-86399). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZBBX Antibody (NBP2-86399) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZBBX Products

Array NBP2-86399

Bioinformatics Tool for ZBBX Antibody (NBP2-86399)

Discover related pathways, diseases and genes to ZBBX Antibody (NBP2-86399). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBBX Antibody (NBP2-86399)

Discover more about diseases related to ZBBX Antibody (NBP2-86399).

Blogs on ZBBX

There are no specific blogs for ZBBX, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBBX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBBX