YIPF7 Antibody


Immunohistochemistry: YIPF7 Antibody [NBP1-90456] - Staining of human prostate shows moderate cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

YIPF7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
YIPF7 Protein (NBP1-90456PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for YIPF7 Antibody

  • Yip1 domain family, member 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for YIPF7 Antibody (NBP1-90456) (0)

There are no publications for YIPF7 Antibody (NBP1-90456).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YIPF7 Antibody (NBP1-90456) (0)

There are no reviews for YIPF7 Antibody (NBP1-90456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for YIPF7 Antibody (NBP1-90456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional YIPF7 Products

YIPF7 NBP1-90456

Bioinformatics Tool for YIPF7 Antibody (NBP1-90456)

Discover related pathways, diseases and genes to YIPF7 Antibody (NBP1-90456). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on YIPF7

There are no specific blogs for YIPF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our YIPF7 Antibody and receive a gift card or discount.


Gene Symbol YIPF7