YANK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YANK2 Antibody [NBP2-56081] - Staining of human cell line U-2 OS shows localization to microtubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YANK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV
Specificity
Specificity of human YANK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK32B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YANK2 Recombinant Protein Antigen (NBP2-56081PEP)

Reactivity Notes

Mouse 86%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for YANK2 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • gene for serine/threonine protein kinase
  • serine/threonine kinase 32B
  • serine/threonine-protein kinase 32B
  • STK32
  • STKG6
  • YANK2HSA250839

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1216
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-84038
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-21005
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS139
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-89463
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
AF3720
Species: Hu, Mu
Applications: WB, ICC
H00065975-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP

Publications for YANK2 Antibody (NBP2-56081) (0)

There are no publications for YANK2 Antibody (NBP2-56081).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YANK2 Antibody (NBP2-56081) (0)

There are no reviews for YANK2 Antibody (NBP2-56081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YANK2 Antibody (NBP2-56081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional YANK2 Products

Bioinformatics Tool for YANK2 Antibody (NBP2-56081)

Discover related pathways, diseases and genes to YANK2 Antibody (NBP2-56081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YANK2 Antibody (NBP2-56081)

Discover more about diseases related to YANK2 Antibody (NBP2-56081).
 

Pathways for YANK2 Antibody (NBP2-56081)

View related products by pathway.

Research Areas for YANK2 Antibody (NBP2-56081)

Find related products by research area.

Blogs on YANK2

There are no specific blogs for YANK2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YANK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK32B