Recombinant Human YAF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human YAF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 22282 of Human YAF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
YAF2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human YAF2 Protein

  • DKFZp779H1820
  • MGC41856
  • YY1 associated factor 2
  • YY1-associated factor 2

Background

The protein encoded by this gene interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. This gene product itself contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00002553-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF4050
Species: Hu, Mu
Applications: WB, ICC
NBP1-85040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP

Publications for YAF2 Partial Recombinant Protein (H00010138-Q01) (0)

There are no publications for YAF2 Partial Recombinant Protein (H00010138-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YAF2 Partial Recombinant Protein (H00010138-Q01) (0)

There are no reviews for YAF2 Partial Recombinant Protein (H00010138-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YAF2 Partial Recombinant Protein (H00010138-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional YAF2 Products

Bioinformatics Tool for YAF2 Partial Recombinant Protein (H00010138-Q01)

Discover related pathways, diseases and genes to YAF2 Partial Recombinant Protein (H00010138-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YAF2 Partial Recombinant Protein (H00010138-Q01)

Discover more about diseases related to YAF2 Partial Recombinant Protein (H00010138-Q01).
 

Pathways for YAF2 Partial Recombinant Protein (H00010138-Q01)

View related products by pathway.

PTMs for YAF2 Partial Recombinant Protein (H00010138-Q01)

Learn more about PTMs related to YAF2 Partial Recombinant Protein (H00010138-Q01).

Blogs on YAF2

There are no specific blogs for YAF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

YAF2 Antibody
NBP1-89444
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human YAF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol YAF2