WDR65 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WDR65 Antibody [NBP1-82008] - Staining of human cell line HaCaT shows localization to cytosol.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human nasopharynx shows strong membranous positivity in respiratory epithelial cells.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining in human fallopian tube and prostate tissues using anti-CFAP57 antibody. Corresponding CFAP57 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human lymph node.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human liver.

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human fallopian tube, liver, lymph node and prostate using Anti-WDR65 antibody NBP1-82008 (A) shows similar protein distribution across tissues to independent antibody NBP1-82009 (B).

Immunohistochemistry-Paraffin: WDR65 Antibody [NBP1-82008] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR65 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WDR65 Antibody - BSA Free (NBP1-82008) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR65
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  WDR65 Protein (NBP1-82008PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WDR65 Antibody - BSA Free

• FLJ32000
• VWS2
• WD repeat domain 65
• WD repeat-containing protein 65

Background

WDR65 is a gene that codes for a protein with two isoforms, with lengths of 1250 and 698 amino acids, and weights of approximately 145 and 78 kDa respectively. WDR65 helps in the formation of protein-protein complexes in the craniofacial region. Current research is being done on diseases and disorders related to this gene including Van der Woude syndrome, cleft lip, cleft palate, and malaria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR65