WDR65 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WDR65 Antibody [NBP1-82008] - Staining of human cell line HaCaT shows localization to cytosol.

Analysis in human fallopian tube and prostate tissues. Corresponding RNA-seq data are presented for the same tissues.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human lymph node shows no positivity in lymphoid cells as expected.

Staining of human prostate shows no positivity in glandular cells as expected.

Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Staining of human fallopian tube, liver, lymph node and prostate HPA028623 (A) shows similar protein distribution across tissues to independent antibody HPA002736 (B).

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR65 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR65
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  WDR65 Protein (NBP1-82008PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WDR65 Antibody - BSA Free

• FLJ32000
• VWS2
• WD repeat domain 65
• WD repeat-containing protein 65

Background

WDR65 is a gene that codes for a protein with two isoforms, with lengths of 1250 and 698 amino acids, and weights of approximately 145 and 78 kDa respectively. WDR65 helps in the formation of protein-protein complexes in the craniofacial region. Current research is being done on diseases and disorders related to this gene including Van der Woude syndrome, cleft lip, cleft palate, and malaria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR65