Recombinant Human WDR6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WDR6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1022-1121 of Human WDR6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD

Protein/Peptide Type
Partial Recombinant Protein
Gene
WDR6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WDR6 Protein

  • FLJ10218
  • FLJ52552
  • FLJ56107
  • MGC126756
  • MGC142027
  • WD repeat domain 6
  • WD repeat-containing protein 6

Background

WDR6 - WD repeat domain 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14130
Species: Hu
Applications: IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-88501
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-89382
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB

Publications for WDR6 Partial Recombinant Protein (H00011180-Q01) (0)

There are no publications for WDR6 Partial Recombinant Protein (H00011180-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR6 Partial Recombinant Protein (H00011180-Q01) (0)

There are no reviews for WDR6 Partial Recombinant Protein (H00011180-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR6 Partial Recombinant Protein (H00011180-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR6 Products

Bioinformatics Tool for WDR6 Partial Recombinant Protein (H00011180-Q01)

Discover related pathways, diseases and genes to WDR6 Partial Recombinant Protein (H00011180-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR6 Partial Recombinant Protein (H00011180-Q01)

Discover more about diseases related to WDR6 Partial Recombinant Protein (H00011180-Q01).
 

Pathways for WDR6 Partial Recombinant Protein (H00011180-Q01)

View related products by pathway.

Blogs on WDR6

There are no specific blogs for WDR6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WDR6 Antibody
NBP1-92588
Dicer Antibody
NBP1-06520

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WDR6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR6