VSIG10L Antibody


Immunocytochemistry/ Immunofluorescence: VSIG10L Antibody [NBP2-32542] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: VSIG10L Antibody [NBP2-32542] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in Leydig cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

VSIG10L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VLTWDVERGALISSFEIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVY
Specificity of human VSIG10L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VSIG10L Protein (NBP2-32542PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for VSIG10L Antibody

  • V-Set And Immunoglobulin Domain Containing 10 Like
  • V-Set And Immunoglobulin Domain-Containing Protein 10-Like
  • VSIG10L


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VSIG10L Antibody (NBP2-32542) (0)

There are no publications for VSIG10L Antibody (NBP2-32542).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSIG10L Antibody (NBP2-32542) (0)

There are no reviews for VSIG10L Antibody (NBP2-32542). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VSIG10L Antibody (NBP2-32542) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VSIG10L Products

Diseases for VSIG10L Antibody (NBP2-32542)

Discover more about diseases related to VSIG10L Antibody (NBP2-32542).

Pathways for VSIG10L Antibody (NBP2-32542)

View related products by pathway.

Blogs on VSIG10L

There are no specific blogs for VSIG10L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VSIG10L Antibody and receive a gift card or discount.

