ZNF835 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF835 Antibody [NBP2-13600] - Staining of human uterus, post-menopause shows strong cytoplasmic positivity in a subset of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF835 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQGAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFS RIPRTISSPAATQASVPDDSSSRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF835
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF835 Protein (NBP2-13600PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF835 Antibody

  • BC37295_3
  • zinc finger protein 835

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86851
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001415-M02
Species: Hu
Applications: WB, ELISA
NBP2-46016
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
NBP2-55056
Species: Hu
Applications: WB, ICC/IF
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80837
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-56848
Species: Hu
Applications: WB
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-85250
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13600
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF835 Antibody (NBP2-13600) (0)

There are no publications for ZNF835 Antibody (NBP2-13600).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF835 Antibody (NBP2-13600) (0)

There are no reviews for ZNF835 Antibody (NBP2-13600). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF835 Antibody (NBP2-13600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF835 Products

Bioinformatics Tool for ZNF835 Antibody (NBP2-13600)

Discover related pathways, diseases and genes to ZNF835 Antibody (NBP2-13600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF835 Antibody (NBP2-13600)

Discover more about diseases related to ZNF835 Antibody (NBP2-13600).
 

Pathways for ZNF835 Antibody (NBP2-13600)

View related products by pathway.

Blogs on ZNF835

There are no specific blogs for ZNF835, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF835 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF835