VPS45 Recombinant Protein Antigen

Images

 
There are currently no images for VPS45 Protein (NBP1-81641PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VPS45 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS45.

Source: E. coli

Amino Acid Sequence: LLNQWTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKKPKEQQKLESIADMKAFVENYPQFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VPS45
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81641.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VPS45 Recombinant Protein Antigen

  • H1
  • H1VPS45
  • hlVps45
  • h-vps45
  • leucocyte vacuolar protein sorting 45
  • vacuolar protein sorting 45 homolog (S. cerevisiae)
  • vacuolar protein sorting 45A (yeast homolog)
  • vacuolar protein sorting 45A (yeast)
  • vacuolar protein sorting 45A
  • vacuolar protein sorting-associated protein 45
  • VPS45A
  • VPS45AVPS54A
  • VPS45B
  • VSP45
  • VSP45A

Background

FUNCTION: May play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network. SUBUNIT: Interacts with STX6 and ZFYVE20. SUBCELLULAR LOCATION: Golgi apparatus membrane; Peripheral membrane protein. Endosome membrane; Peripheral membrane protein. Note: Associated with Golgi/endosomal vesicles and the trans-Golgi network. TISSUE SPECIFICITY: Ubiquitous; expression was highest in testis and in brain. Detected in every part of the brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02031
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
MAB8306
Species: Hu
Applications: IHC, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92467
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF5675
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
AF1049
Species: Hu
Applications: IHC, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
DPI00
Species: Hu
Applications: ELISA
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-81641PEP
Species: Hu
Applications: AC

Publications for VPS45 Protein (NBP1-81641PEP) (0)

There are no publications for VPS45 Protein (NBP1-81641PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS45 Protein (NBP1-81641PEP) (0)

There are no reviews for VPS45 Protein (NBP1-81641PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VPS45 Protein (NBP1-81641PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS45 Products

Research Areas for VPS45 Protein (NBP1-81641PEP)

Find related products by research area.

Blogs on VPS45

There are no specific blogs for VPS45, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VPS45 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS45