VPS18 Antibody (4E9)

Images

 
Western Blot: VPS18 Antibody (4E9) [H00057617-M04] - VPS18 monoclonal antibody (M04), clone 4E9. Western Blot analysis of VPS18 expression in K-562 ( Cat # L009V1 ).
Immunoprecipitation: VPS18 Antibody (4E9) [H00057617-M04] - Analysis of VPS18 transfected lysate using anti-VPS18 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with VPS18 rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
4E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VPS18 Antibody (4E9) Summary

Immunogen
VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Specificity
VPS18 - vacuolar protein sorting protein 18 (4E9)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VPS18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VPS18 Antibody (4E9)

  • hVPS18
  • KIAA1475PEP3
  • vacuolar protein sorting 18 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 18
  • vacuolar protein sorting-associated protein 18 homolog

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VPS18 Antibody (H00057617-M04) (0)

There are no publications for VPS18 Antibody (H00057617-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS18 Antibody (H00057617-M04) (0)

There are no reviews for VPS18 Antibody (H00057617-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS18 Antibody (H00057617-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS18 Products

Research Areas for VPS18 Antibody (H00057617-M04)

Find related products by research area.

Blogs on VPS18

There are no specific blogs for VPS18, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS18 Antibody (4E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS18
Entrez
Uniprot