visinin-like 1 Antibody [mFluor Violet 450 SE] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 2-191 of human visinin-like 1 (NP_003376.2).
Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
VSNL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for visinin-like 1 Antibody [mFluor Violet 450 SE]
Background
visinin-like 1 is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for visinin-like 1 Antibody (NBP3-38015MFV450) (0)
There are no publications for visinin-like 1 Antibody (NBP3-38015MFV450).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for visinin-like 1 Antibody (NBP3-38015MFV450) (0)
There are no reviews for visinin-like 1 Antibody (NBP3-38015MFV450).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for visinin-like 1 Antibody (NBP3-38015MFV450) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional visinin-like 1 Products
Research Areas for visinin-like 1 Antibody (NBP3-38015MFV450)
Find related products by research area.
|
Blogs on visinin-like 1