Viperin Recombinant Protein Antigen

Images

 
There are currently no images for Viperin Recombinant Protein Antigen (NBP2-58186PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Viperin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Viperin.

Source: E. coli

Amino Acid Sequence: YLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RSAD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58186.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Viperin Recombinant Protein Antigen

  • 2510004L01Rik
  • cig33
  • cig5
  • Cytomegalovirus-induced gene 5 protein
  • interferon-inducible
  • radical S-adenosyl methionine domain containing 2
  • radical S-adenosyl methionine domain-containing protein 2
  • vig1
  • viperin
  • Virus inhibitory protein, endoplasmic reticulum-associated

Background

Viperin is involved in antiviral defense. May impair virus budding by disrupting lipid rafts at the plasma membrane, afeature which is essential for the budding process of many viruses. Acts through binding with and inactivating FPPS,an enzyme involved in synthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32905
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
UL-553
Species: Hu
Applications: EnzAct
NBP2-02340
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
DIP100
Species: Hu
Applications: ELISA
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-83132
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85348
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Viperin Recombinant Protein Antigen (NBP2-58186PEP) (0)

There are no publications for Viperin Recombinant Protein Antigen (NBP2-58186PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Viperin Recombinant Protein Antigen (NBP2-58186PEP) (0)

There are no reviews for Viperin Recombinant Protein Antigen (NBP2-58186PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Viperin Recombinant Protein Antigen (NBP2-58186PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Viperin Products

Research Areas for Viperin Recombinant Protein Antigen (NBP2-58186PEP)

Find related products by research area.

Blogs on Viperin.

Viperin: A Cellular Inhibitor of DNA and RNA Viruses
Viperin (Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) inhibits the replication of a broad spectrum of viruses by several diverse mechanisms. The protein was first identified in 2001, when it was found to be the pro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Viperin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RSAD2