Viperin Antibody

Product Discontinued

Viperin Antibody Summary

• Immunogen: Synthetic peptides corresponding to RSAD2(radical S-adenosyl methionine domain containing 2) The peptide sequence was selected from the N terminal of RSAD2. Peptide sequence PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP.
• Predicted Species: Mouse (100%), Rat (100%), Equine (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RSAD2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against RSAD2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Viperin Antibody

• 2510004L01Rik
• cig33
• cig5
• Cytomegalovirus-induced gene 5 protein
• interferon-inducible
• radical S-adenosyl methionine domain containing 2
• radical S-adenosyl methionine domain-containing protein 2
• vig1
• viperin
• Virus inhibitory protein, endoplasmic reticulum-associated

Background

RSAD2 is a potential antiviral effector. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RSAD2
• Uniprot:
  • Q8WXG1(Human)