VCX3A Antibody (6A3) - Azide and BSA Free Summary
| Immunogen |
VCX3A (NP_057463, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQ |
| Specificity |
VCX3A - variable charge, X-linked 3A |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
VCX3A |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Publications |
|
Reactivity Notes
Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for VCX3A Antibody (6A3) - Azide and BSA Free
Background
This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for VCX3A Antibody (H00051481-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for VCX3A Antibody (H00051481-M01) (0)
There are no reviews for VCX3A Antibody (H00051481-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VCX3A Antibody (H00051481-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VCX3A Products
Research Areas for VCX3A Antibody (H00051481-M01)
Find related products by research area.
|
Blogs on VCX3A