Recombinant Human VABP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human VABP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-216 of Human KCNIP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KCNIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
49.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VABP Protein

  • A-type potassium channel modulatory protein 1
  • KChIP1
  • KCHIP1MGC95
  • Kv channel interacting protein 1
  • Kv channel-interacting protein 1
  • potassium channel interacting protein 1
  • Potassium channel-interacting protein 1
  • VABP
  • Vesicle APC-binding protein

Background

KCNIP1( AAH50375, 1 a.a. - 217 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54705
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-47481
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
H00030820-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for VABP Recombinant Protein (H00030820-P01) (0)

There are no publications for VABP Recombinant Protein (H00030820-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VABP Recombinant Protein (H00030820-P01) (0)

There are no reviews for VABP Recombinant Protein (H00030820-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VABP Recombinant Protein (H00030820-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VABP Products

Bioinformatics Tool for VABP Recombinant Protein (H00030820-P01)

Discover related pathways, diseases and genes to VABP Recombinant Protein (H00030820-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VABP Recombinant Protein (H00030820-P01)

Discover more about diseases related to VABP Recombinant Protein (H00030820-P01).
 

Pathways for VABP Recombinant Protein (H00030820-P01)

View related products by pathway.

PTMs for VABP Recombinant Protein (H00030820-P01)

Learn more about PTMs related to VABP Recombinant Protein (H00030820-P01).

Blogs on VABP

There are no specific blogs for VABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VABP Antibody
NBP2-19020

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VABP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNIP1