Recombinant Human UTS2D Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UTS2D Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 119 of Human UTS2D full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UTS2D
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UTS2D Protein

  • MGC138371
  • U2B
  • U-IIB
  • urotensin 2 domain containing
  • Urotensin IIB
  • Urotensin II-related peptide
  • Urotensin-2 domain-containing protein
  • urotensin-2B
  • URPUIIB
  • UTS2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001325-P01
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00257313-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for UTS2D Recombinant Protein (H00257313-P01) (0)

There are no publications for UTS2D Recombinant Protein (H00257313-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTS2D Recombinant Protein (H00257313-P01) (0)

There are no reviews for UTS2D Recombinant Protein (H00257313-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTS2D Recombinant Protein (H00257313-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UTS2D Products

Bioinformatics Tool for UTS2D Recombinant Protein (H00257313-P01)

Discover related pathways, diseases and genes to UTS2D Recombinant Protein (H00257313-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UTS2D Recombinant Protein (H00257313-P01)

Discover more about diseases related to UTS2D Recombinant Protein (H00257313-P01).
 

Pathways for UTS2D Recombinant Protein (H00257313-P01)

View related products by pathway.

PTMs for UTS2D Recombinant Protein (H00257313-P01)

Learn more about PTMs related to UTS2D Recombinant Protein (H00257313-P01).

Blogs on UTS2D

There are no specific blogs for UTS2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UTS2D Antibody
NBP1-80652

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UTS2D Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UTS2D