USP47 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

USP47 Recombinant Protein Summary

Description
USP47 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
USP47

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP47 Recombinant Protein

  • Deubiquitinating enzyme 47
  • DKFZp686C13257
  • EC 3.4.19.12
  • FLJ20727
  • Trf (TATA binding protein-related factor)-proximal homolog (Drosophila)
  • Trf (TATA binding protein-related factor)-proximal homolog
  • TRFP
  • ubiquitin carboxyl-terminal hydrolase 47
  • ubiquitin specific peptidase 47
  • ubiquitin specific protease 47
  • ubiquitin thioesterase 47
  • Ubiquitin thiolesterase 47
  • Ubiquitin-specific-processing protease 47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF3994
Species: Hu
Applications: WB
NB100-91906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-91011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89909
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-81173
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF276
Species: Hu
Applications: WB, Flow, IHC, Block
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055031-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP47 Recombinant Protein (H00055031-P01) (0)

There are no publications for USP47 Recombinant Protein (H00055031-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP47 Recombinant Protein (H00055031-P01) (0)

There are no reviews for USP47 Recombinant Protein (H00055031-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP47 Recombinant Protein (H00055031-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP47 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for USP47 Recombinant Protein (H00055031-P01)

Discover related pathways, diseases and genes to USP47 Recombinant Protein (H00055031-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP47 Recombinant Protein (H00055031-P01)

Discover more about diseases related to USP47 Recombinant Protein (H00055031-P01).
 

Pathways for USP47 Recombinant Protein (H00055031-P01)

View related products by pathway.

Blogs on USP47

There are no specific blogs for USP47, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol USP47

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00055031-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
USP47 Antibody
NB100-57487
USP47 Antibody
NB100-57487
USP47 Antibody
NB100-57487