Recombinant Human USP47 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human USP47 Protein Summary

Description
USP47 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
USP47

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP47 Protein

  • Deubiquitinating enzyme 47
  • DKFZp686C13257
  • EC 3.4.19.12
  • FLJ20727
  • Trf (TATA binding protein-related factor)-proximal homolog (Drosophila)
  • Trf (TATA binding protein-related factor)-proximal homolog
  • TRFP
  • ubiquitin carboxyl-terminal hydrolase 47
  • ubiquitin specific peptidase 47
  • ubiquitin specific protease 47
  • ubiquitin thioesterase 47
  • Ubiquitin thiolesterase 47
  • Ubiquitin-specific-processing protease 47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF1555
Species: Hu
Applications: WB
MAB6798
Species: Hu
Applications: WB, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-81174
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055031-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP47 Recombinant Protein (H00055031-P01) (0)

There are no publications for USP47 Recombinant Protein (H00055031-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP47 Recombinant Protein (H00055031-P01) (0)

There are no reviews for USP47 Recombinant Protein (H00055031-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP47 Recombinant Protein (H00055031-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human USP47 Protein Products

Related Products by Gene

Bioinformatics Tool for USP47 Recombinant Protein (H00055031-P01)

Discover related pathways, diseases and genes to USP47 Recombinant Protein (H00055031-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP47 Recombinant Protein (H00055031-P01)

Discover more about diseases related to USP47 Recombinant Protein (H00055031-P01).
 

Pathways for USP47 Recombinant Protein (H00055031-P01)

View related products by pathway.

Blogs on USP47

There are no specific blogs for USP47, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP47 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP47

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
USP47 Antibody
NB100-57487
USP47 Antibody
NB100-57487
USP47 Antibody
NB100-57487