Recombinant Human USP37 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human USP37 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 123-228 of Human USP37 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ILGSRTSQKETSRQLSYSDNQASAKRGSLETKDDIPFRKVLGNPGRGSIKTVAGSGIARTIPSLTSTSTPLRSGLLENRTEKRKRMISTGSELNEDYPKENDSSSN

Protein/Peptide Type
Partial Recombinant Protein
Gene
USP37

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP37 Protein

  • Deubiquitinating enzyme 37
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1594tmp_locus_50
  • MGC117261
  • ubiquitin carboxyl-terminal hydrolase 37
  • ubiquitin specific peptidase 37
  • ubiquitin specific protease 37
  • ubiquitin thioesterase 37
  • Ubiquitin thiolesterase 37
  • Ubiquitin-specific-processing protease 37
  • USP37

Background

USP37 - ubiquitin specific protease 37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NBP1-30447
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for USP37 Partial Recombinant Protein (H00057695-Q01) (0)

There are no publications for USP37 Partial Recombinant Protein (H00057695-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP37 Partial Recombinant Protein (H00057695-Q01) (0)

There are no reviews for USP37 Partial Recombinant Protein (H00057695-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP37 Partial Recombinant Protein (H00057695-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP37 Products

Bioinformatics Tool for USP37 Partial Recombinant Protein (H00057695-Q01)

Discover related pathways, diseases and genes to USP37 Partial Recombinant Protein (H00057695-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP37 Partial Recombinant Protein (H00057695-Q01)

Discover more about diseases related to USP37 Partial Recombinant Protein (H00057695-Q01).
 

Pathways for USP37 Partial Recombinant Protein (H00057695-Q01)

View related products by pathway.

PTMs for USP37 Partial Recombinant Protein (H00057695-Q01)

Learn more about PTMs related to USP37 Partial Recombinant Protein (H00057695-Q01).
 

Research Areas for USP37 Partial Recombinant Protein (H00057695-Q01)

Find related products by research area.

Blogs on USP37

There are no specific blogs for USP37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

USP37 Antibody
NBP1-82901

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP37 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP37
Entrez