Recombinant Human USP34 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human USP34 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 3296-3395 of Human USP34 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS

Protein/Peptide Type
Partial Recombinant Protein
Gene
USP34

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP34 Protein

  • Deubiquitinating enzyme 34
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ43910
  • KIAA0570MGC104459
  • KIAA0729ubiquitin carboxyl-terminal hydrolase 34
  • ubiquitin specific peptidase 34
  • ubiquitin specific protease 34
  • ubiquitin thioesterase 34
  • Ubiquitin thiolesterase 34
  • Ubiquitin-specific-processing protease 34

Background

USP34 - ubiquitin specific protease 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
H00009736-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP34 Partial Recombinant Protein (H00009736-Q01) (0)

There are no publications for USP34 Partial Recombinant Protein (H00009736-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP34 Partial Recombinant Protein (H00009736-Q01) (0)

There are no reviews for USP34 Partial Recombinant Protein (H00009736-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP34 Partial Recombinant Protein (H00009736-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP34 Products

Bioinformatics Tool for USP34 Partial Recombinant Protein (H00009736-Q01)

Discover related pathways, diseases and genes to USP34 Partial Recombinant Protein (H00009736-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP34 Partial Recombinant Protein (H00009736-Q01)

Discover more about diseases related to USP34 Partial Recombinant Protein (H00009736-Q01).
 

Pathways for USP34 Partial Recombinant Protein (H00009736-Q01)

View related products by pathway.

PTMs for USP34 Partial Recombinant Protein (H00009736-Q01)

Learn more about PTMs related to USP34 Partial Recombinant Protein (H00009736-Q01).

Blogs on USP34

There are no specific blogs for USP34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

USP9x Antibody
NBP1-48321
USP34 Antibody (2E2)
H00009736-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP34 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP34