USP29 Antibody - Azide and BSA Free

Western Blot: USP29 Antibody [NBP2-94672] - Western blot analysis of extracts of various cell lines, using usp29 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.

Product Discontinued

USP29 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human usp29 (NP_065954.1). LKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP29
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 104 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for USP29 Antibody - Azide and BSA Free

• Deubiquitinating enzyme 29
• EC 3.1.2.15
• EC 3.4.19.12
• HOM-TES-84/86
• MGC163266
• MGC163270
• ubiquitin carboxyl-terminal hydrolase 29
• ubiquitin specific peptidase 29
• ubiquitin specific protease 29
• ubiquitin thioesterase 29
• Ubiquitin thiolesterase 29
• ubiquitin-specific processing protease
• Ubiquitin-specific-processing protease 29
• USP29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: USP29