We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Urotensin-2 Recombinant Protein Antigen

Images

 
There are currently no images for Urotensin-2 Protein (NBP1-87223PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Urotensin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UTS2.

Source: E. coli

Amino Acid Sequence: TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UTS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87223.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Urotensin-2 Recombinant Protein Antigen

  • UCN2
  • UII
  • UIIPRO1068
  • U-IIUrotensin II
  • urotensin 2
  • urotensin-2
  • UrotensinII
  • Urotensin-II
  • UTS2

Background

Urotensin-2 encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80652
Species: Hu
Applications: IHC,  IHC-P
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
MAB7447
Species: Hu
Applications: IHC, WB
QET00B
Species: Hu
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-57317
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-93822
Species: Hu, Mu, Rt
Applications: WB
9134-TN
Species: Hu
Applications: BA
NB100-93444
Species: Hu
Applications: PEP-ELISA, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56485
Species: Bv, Ca, Ch, Hu, Ma, Mu, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, Simple Western, WB

Publications for Urotensin-2 Protein (NBP1-87223PEP) (0)

There are no publications for Urotensin-2 Protein (NBP1-87223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Urotensin-2 Protein (NBP1-87223PEP) (0)

There are no reviews for Urotensin-2 Protein (NBP1-87223PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Urotensin-2 Protein (NBP1-87223PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Urotensin-2 Products

Research Areas for Urotensin-2 Protein (NBP1-87223PEP)

Find related products by research area.

Blogs on Urotensin-2

There are no specific blogs for Urotensin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Urotensin-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UTS2