Urocortin 3 Antibody

Immunohistochemistry-Paraffin: Urocortin 3 Antibody [NBP1-80732] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Product Discontinued

Urocortin 3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UCN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23778137)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Urocortin 3 Antibody

• MGC119002
• SPCSCP
• stresscopin
• Ucn III
• UCNIII
• urocortin 3 (stresscopin)
• Urocortin III
• urocortin-3

Background

Urocortin 3 is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it may be responsible for the effects of stress on appetite. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin II. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Urocortin 3 Antibody (NBP1-80732)(3)

Publications using NBP1-80732

• Milara J, MartInez-ExpOsito F, Montero P et al. N-acetylcysteine Reduces Inflammasome Activation Induced by SARS-CoV-2 Proteins In Vitro International Journal of Molecular Sciences 2022-11-22 [PMID: 36498845] (In vitro)
  
  Details:
  differentiated 937 macrophages were stimulated
• McBrearty N, Cho C, Chen J et al. Tumor suppressive and immune-stimulating roles of cholesterol 25-hydroxylase in pancreatic cancer cells Molecular cancer research : MCR 2022-11-15 [PMID: 36378658]
• Hua H, Shang L, Martinez H et al. iPSC-derived beta cells model diabetes due to glucokinase deficiency. J Clin Invest 2013-07-01 [PMID: 23778137]

Bioinformatics

• Gene Symbol: UCN3
• Entrez:
  • 114131(Human)
• Uniprot:
  • Q969E3(Human)