Urocortin 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Urocortin 3 Antibody [NBP1-80732] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Urocortin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEK
Specificity
Specificity of human Urocortin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UCN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-80732.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23778137)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Urocortin 3 Antibody

  • MGC119002
  • SPCSCP
  • stresscopin
  • Ucn III
  • UCNIII
  • urocortin 3 (stresscopin)
  • Urocortin III
  • urocortin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5805
Species: Hu
Applications: WB
NBP2-94031
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
9134-TN
Species: Hu
NB100-56485
Species: Hu, Mu, Rt, Bv, Ca, Ch
Applications: WB, Simple Western, ICC/IF
MAB7447
Species: Hu
Applications: WB, IHC
NBP1-00175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94140
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
H00008720-Q01
Species: Hu
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15698
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-12553
Species: Hu

Publications for Urocortin 3 Antibody (NBP1-80732)(1)


Reviews for Urocortin 3 Antibody (NBP1-80732) (0)

There are no reviews for Urocortin 3 Antibody (NBP1-80732). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Urocortin 3 Antibody (NBP1-80732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Urocortin 3 Products

Bioinformatics Tool for Urocortin 3 Antibody (NBP1-80732)

Discover related pathways, diseases and genes to Urocortin 3 Antibody (NBP1-80732). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Urocortin 3 Antibody (NBP1-80732)

Discover more about diseases related to Urocortin 3 Antibody (NBP1-80732).
 

Pathways for Urocortin 3 Antibody (NBP1-80732)

View related products by pathway.

PTMs for Urocortin 3 Antibody (NBP1-80732)

Learn more about PTMs related to Urocortin 3 Antibody (NBP1-80732).

Blogs on Urocortin 3

There are no specific blogs for Urocortin 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Urocortin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UCN3
Entrez
Uniprot
COVID-19 update