UNC50 Antibody

Immunohistochemistry-Paraffin: UNC50 Antibody [NBP1-81816] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Discontinued

UNC50 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC50
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: HIER pH6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UNC50 Antibody

• geal-6 membrane-associated high-copy suppressor 1
• GMH1
• hGMH1
• PDLs22
• Periodontal ligament-specific protein 22
• Protein GMH1 homolog
• protein unc-50 homolog
• unc-50 homolog (C. elegans)
• unc-50 related
• UNCLDKFZp564G0222
• Uncoordinated-like protein
• URP

Background

UNC50 may be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UNC50