Recombinant Human UBR1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human UBR1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human UBR1

Source: Wheat Germ

Amino Acid Sequence: ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
UBR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UBR1 Protein

  • E3 ubiquitin-protein ligase UBR1
  • E3a ligase
  • EC 6.3.2.-
  • JBS
  • MGC142065
  • MGC142067
  • N-recognin-1
  • ubiquitin ligase E3 alpha-I
  • ubiquitin protein ligase E3 component n-recognin 1
  • ubiquitin-protein ligase E3-alpha
  • Ubiquitin-protein ligase E3-alpha-1
  • Ubiquitin-protein ligase E3-alpha-I

Background

UBR1 - ubiquitin protein ligase E3 component n-recognin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NB100-553
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow

Publications for UBR1 Partial Recombinant Protein (H00197131-Q01) (0)

There are no publications for UBR1 Partial Recombinant Protein (H00197131-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBR1 Partial Recombinant Protein (H00197131-Q01) (0)

There are no reviews for UBR1 Partial Recombinant Protein (H00197131-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBR1 Partial Recombinant Protein (H00197131-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBR1 Products

Bioinformatics Tool for UBR1 Partial Recombinant Protein (H00197131-Q01)

Discover related pathways, diseases and genes to UBR1 Partial Recombinant Protein (H00197131-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR1 Partial Recombinant Protein (H00197131-Q01)

Discover more about diseases related to UBR1 Partial Recombinant Protein (H00197131-Q01).
 

Pathways for UBR1 Partial Recombinant Protein (H00197131-Q01)

View related products by pathway.

PTMs for UBR1 Partial Recombinant Protein (H00197131-Q01)

Learn more about PTMs related to UBR1 Partial Recombinant Protein (H00197131-Q01).

Blogs on UBR1

There are no specific blogs for UBR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RAD18 Antibody (3H7)
H00056852-M01
UBR1 Antibody
NBP1-86253

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UBR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR1