UBN1 Antibody

Immunohistochemistry-Paraffin: UBN1 Antibody [NBP2-49579] - Analysis in human fallopian tube and pancreas tissues using antibody. Corresponding UBN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: UBN1 Antibody [NBP2-49579] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: UBN1 Antibody [NBP2-49579] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: UBN1 Antibody [NBP2-49579] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: UBN1 Antibody [NBP2-49579] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

UBN1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UBN1 Recombinant Protein Antigen (NBP2-49579PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UBN1 Antibody

• HIRA-binding protein
• ubinuclein 1
• ubinuclein-1
• VT
• VT4

Background

UBN1 acts as a novel regulator of senescence. Involved in the formation of senescence-associated heterochromatin foci (SAHF), which represses expression of proliferation-promoting genes. Binds to proliferation-promoting genes. May be required for replication-i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBN1